KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0042Help
Entry
Za10_0042         CDS       T01110                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Za10_0042
   00240 Pyrimidine metabolism
    Za10_0042
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Za10_0042
   03430 Mismatch repair
    Za10_0042
   03440 Homologous recombination
    Za10_0042
Enzymes [BR:zmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Za10_0042
DNA replication proteins [BR:zmn03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Za10_0042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
48863..49309
Genome map
AA seq 148 aa AA seqDB search
MVARVDFYHLLSAKLENILPRIAEKTLSSDKKLLVIVPDDQQARYWDDYLWRYEDTSFLP
HGRVGGGDEAEHPVLISTAMEAVNQASYIALTDGLWRAEALNFERVFYFFDEIAVQQARQ
AWRSLKNIDGECHYWKQDEQTGQWKAIA
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
ttggtagcacgggttgatttttatcatttgctttcggcaaagctggaaaatattctgccg
cgtattgcggaaaaaacattgtccagcgataaaaaattgctggttatcgtccccgatgac
cagcaagcccgctactgggatgactatctttggcgttatgaagataccagctttctccct
catggcagggtaggcggtggcgatgaagccgaacatcccgttctaatctcgacggcaatg
gaggcggtcaatcaggcaagctatattgcgctaacagacggattatggcgagcagaggcc
ttaaatttcgagagagtattttattttttcgatgaaatcgcggtgcaacaagcgcggcaa
gcttggcggtctttgaaaaatatcgacggtgaatgccattactggaaacaggatgaacag
acggggcagtggaaggccatagcctaa

DBGET integrated database retrieval system