KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0095Help
Entry
Za10_0095         CDS       T01110                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Za10_0095
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Za10_0095
  Lipid metabolism
   00071 Fatty acid degradation
    Za10_0095
  Amino acid metabolism
   00350 Tyrosine metabolism
    Za10_0095
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Za10_0095
   00626 Naphthalene degradation
    Za10_0095
Enzymes [BR:zmn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Za10_0095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
104028..105287
Genome map
AA seq 419 aa AA seqDB search
MFLQMIFIKLFWAYFYQENLNNHIFIILDLSIDTSDIYKCFYNFLDRNRLAIVFPIFARC
MSAADLSTDLYLSEIYQQKVVTMKAAVITKDHTIEVKDTKLRPLKYGEALLEMEYCGVCH
TDLHVKNGDFGDETGRITGHEGIGIVKQVGEGVTSLKVGDRASVAWFFKGCGHCEYCVSG
NETLCRNVENAGYTVDGAMAEECIVVADYSVKVPDGLDPAVASSITCAGVTTYKAVKVSQ
IQPGQWLAIYGLGGLGNLALQYAKNVFNAKVIAIDVNDEQLAFAKELGADMVINPKNEDA
AKIIQEKVGGAHATVVTAVAKSAFNSAVEAIRAGGRVVAVGLPPEKMDLSIPRLVLDGIE
VLGSLVGTREDLKEAFQFAAEGKVKPKVTKRKVEEINQIFDEMEHGKFTGRMVVDFTHH
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgcaaatgatttttattaaacttttttgggcgtatttttatcaagaaaattta
aataatcacatttttattattttagatttaagtattgatacaagtgatatctataaatgt
ttttataactttctggatcgtaatcggctggcaatcgttttccctatattcgcaagatgt
atgtcagccgcagatttgtcgactgacctctatctctccgagatatatcaacaaaaggta
gtcaccatgaaagcagccgtcataactaaagatcatacgatcgaagtgaaagacaccaaa
ttacgccctctgaaatacggggaagcgcttttggaaatggaatattgcggggtatgtcat
accgatctccatgtgaaaaacggggattttggcgatgaaaccggcagaattaccggccat
gaaggtatcggtatcgtcaagcaggtcggggaaggggttacttctctgaaagtcggtgac
cgcgccagtgttgcatggttcttcaaaggctgcggccattgcgaatattgtgtcagcggg
aatgaaacgctttgccgcaacgttgaaaatgccggttatacggttgacggcgctatggca
gaagaatgcatcgtcgttgccgattactcggtcaaagtgccagatggtcttgatcctgcg
gttgccagcagcatcacttgtgcgggtgtaaccacctataaagcagtcaaagtttctcag
atacagccgggacaatggctggccatctatggcttgggcggtttaggcaatctagccctt
caatatgccaagaatgttttcaacgccaaagtgatcgcgatcgatgtcaatgatgaacag
ctcgcttttgccaaagagctgggcgcagatatggtcatcaatccgaaaaacgaagatgct
gccaaaatcattcaggaaaaagtcggcggcgcacatgcgacggtggtgacggctgttgcc
aaatccgcctttaactcggctgttgaggctatccgcgcgggtggccgtgttgtcgccgtt
ggtctgcctcctgaaaaaatggatttgagcattcctcgtttggtgcttgacggtatcgaa
gtcctaggttccttggtcggaacgcgggaagatttgaaagaggccttccagtttgcagcc
gaaggtaaggtcaaaccgaaagtcaccaagcgtaaagtcgaagaaatcaaccaaatcttt
gacgaaatggaacatggtaaattcacaggccgtatggttgttgattttacccatcactag

DBGET integrated database retrieval system