KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0105Help
Entry
Za10_0105         CDS       T01110                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:zmn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
118426..119031
Genome map
AA seq 201 aa AA seqDB search
MEEIQDLAVMRPDQVNVPEEIQEAIRSLIRWAGDDPDREGLIDTPKRVAKAWKYYCRGYR
EDPENHLKTVFEEVGGYDDIVLLKDIPFYSHCEHHMAPIMGHAHIAYLPDKKVVGLSKLA
RVLKGYAHRLQIQERLTAQVADCIWNNLRPRGVAVVISAVHSCMAARGVETPNVQTVTKT
LRGIYSEDPEQAKMILNLMGV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaatacaagatctggcggttatgcgcccggatcaggtcaatgtgccggaagaa
atacaggaagccattcgcagccttatccgttgggcgggtgatgatcctgatcgggaaggc
ctgattgatacgccaaagcgggttgccaaggcatggaaatattattgtcgggggtatcgg
gaagaccctgaaaaccatttaaaaaccgtttttgaagaagtcggcggctatgacgatatt
gtgctgctgaaagatattccgttctattcgcattgcgaacatcatatggcgccgattatg
gggcatgcccatatcgcctatttgccggataaaaaggttgtcggcctgtcaaaactggcg
cgggtgctgaaagggtatgcccatcgcttgcaaatacaggaaagactgacagcacaagtg
gccgattgtatctggaataatctgcgcccacgcggtgttgcggtggttatttctgcggtg
catagttgtatggccgcgcgtggggtcgaaacccccaatgtccagaccgtcaccaaaacg
ctacgcggtatttacagcgaagaccctgaacaggccaaaatgatccttaatcttatgggt
gtgtaa

DBGET integrated database retrieval system