KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0157Help
Entry
Za10_0157         CDS       T01110                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Za10_0157
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Za10_0157
Enzymes [BR:zmn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Za10_0157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
184196..185230
Genome map
AA seq 344 aa AA seqDB search
MKPVFIGIADTRLSDQEKKLFRQYEPAGYILFQRNITDRTQLKKLTADLRANSQQNIPIL
IDQEGGRVARMKPPVWPAFPAAARFDELYQKAPVSAIEAVRANSHALALLLQDVGINVDC
MPLLDIRDPEGDNIIGDRSFGHNPEQVAALGRAVLDGLAKGSVCGIIKHIPGHGQAKVDS
HKALPVVDSPIEILERDIRPFQHLRNAKMAMTAHIIYQAWDKESCASYSSKIIHDIIRKK
IGFKGLLMSDDIGMNALDGDPVTRALRVFDAGCDVALHCSGKFDDMKAILENMDEIRPES
FAALEKVTNEFSSASDFDLDRAENKALFDRCIAERDALFLEAAV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgtttttattggtatcgctgatactagattatcagatcaggaaaaaaagcta
ttccgtcaatatgaacctgccggttatattctttttcagagaaatattacagaccgtacg
cagctaaagaaattgacggcagatttgagagccaatagccaacagaatattccaatttta
attgatcaggaggggggacgggtcgccagaatgaagccgccggtctggccagcttttcct
gccgccgcccgatttgatgagctttatcagaaagcgccggttagtgcgattgaagctgta
cgtgccaatagccatgcactggctttattattacaggatgttggcatcaatgttgattgt
atgccgttattggacatccgtgatcctgaaggtgataacatcatcggagatcgctctttt
ggtcataatcccgaacaagtcgcagccttaggacgggcggtattagacgggctggcaaaa
ggcagcgtttgcggcattattaaacatattccgggacatggccaagccaaagtggacagt
cacaaagccttgccagtagttgatagtcctatcgaaatattggaacgggatatcaggcct
tttcaacatttacgtaatgcgaaaatggcgatgaccgcccatattatttatcaggcatgg
gataaggaaagctgcgccagctattcttcaaaaattattcacgatattattcgcaaaaaa
atcggttttaaaggccttcttatgtccgacgatatcggcatgaatgctttggatggtgat
ccggtaacacgggcgctacgcgtttttgatgccggttgcgatgtagcactccattgctcc
ggaaaattcgatgatatgaaagctattttagaaaatatggatgagatcagaccagaaagc
tttgctgccttggaaaaggtaaccaatgaattttcaagcgcctctgattttgatttggat
agagcagagaataaagctctttttgatcgctgcattgccgaacgcgatgctttatttcta
gaagcagcagtctag

DBGET integrated database retrieval system