KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0190Help
Entry
Za10_0190         CDS       T01110                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Brite
Enzymes [BR:zmn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Za10_0190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
217418..218863
Genome map
AA seq 481 aa AA seqDB search
MNIKALFGSAVVLAVVAYGATTSYLVHYDHETAPKLSSLSSTNNNPKAKAAFDTIAEARC
DYCHTKDAKLPFYASLPVAKQLMQRDIKRGLQHFQIQPVLNALEKGEAVDEESLARMQFV
VEHDMMPPKMYLTMHWHAALGEKGKKAMLEWIKESRIKNYDAAGLVAPQFQSEPIQPIPT
ADFSDKEKIALGERLFFDKQLSGDGTLNCASCHGLNKGGVDNLVTSTGIKGQKGPINAPT
VYNSVYNKLQFWDGRAKDLQEQAAGPVMNPLEMGSHDWAEVSKRVMAQPGYKEAFTKVYG
GQANQERITNAIAVYEATLVTPDSRFDQYLKGHENAINEQEKRGYALFKDLGCASCHVGK
AMGGQSFEVMGLEGDYFGKRGHPSDADQGRFSQTHNALDMHRFNVPTLRNIELTAPYFHD
GSAKTLEEAVREMVRYQTQKGQIPEKDVQDIVAFLKTQTGSYRGHNLATITEEEAGILPS
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcaaggctttattcgggtctgcggtcgtcttggcagtggtggcctatggggca
acaacctcttatctggttcattacgatcatgaaacagcgcccaaactttcttcgctgtcc
tcgacaaataacaatccgaaagccaaggctgcctttgatacaattgcagaagcccgctgc
gattactgtcataccaaagatgctaaactgcctttttatgctagcttgcccgttgcaaaa
caattgatgcagcgtgacatcaaacgcgggttacagcatttccagatacaaccggtttta
aatgccttggaaaaaggcgaagcggtcgatgaagaatccttggcaagaatgcagttcgtc
gttgaacatgatatgatgccgccgaaaatgtatcttaccatgcattggcatgccgccctt
ggtgaaaagggcaaaaaggctatgctggaatggatcaaggaaagccggattaaaaattat
gatgcggctgggcttgttgcgcctcaatttcagtcggaaccgatacagcctattccgaca
gctgatttttctgacaaagaaaaaatcgcccttggggaacgtctgttctttgataaacag
ctttctggcgatggcactttaaattgtgccagctgtcacggcctgaacaaggggggggtg
gataatctcgtcacctctacgggtatcaaaggacaaaagggtcccattaacgcgcctact
gtttacaattcggtttataacaaactgcaattctgggatggccgagcaaaagatttacag
gagcaggcggcgggtcctgtcatgaatcctctggaaatgggttcccatgattgggcagaa
gttagcaagcgcgttatggcacagccgggctataaagaagcctttacaaaggtctatggc
ggtcaggccaatcaggaacgtattaccaatgcaatcgctgtttatgaggcgactttggta
acgcctgacagtcgttttgaccaatatttaaaaggccatgaaaacgcgatcaacgaacag
gaaaaacgcggttacgcgttgtttaaagatctgggttgtgcttcttgccatgtcggtaaa
gcgatgggtggtcaaagttttgaagttatgggacttgaaggtgactatttcggtaaaaga
ggtcacccaagtgatgccgatcaaggccgtttctctcaaacgcataatgcccttgatatg
catcgtttcaatgtgccaacattacggaatattgaattgacggcaccttatttccacgat
ggcagcgccaaaactttggaagaagccgttcgtgaaatggtgcgctaccagacgcagaaa
ggccaaattcctgaaaaggatgttcaggatattgtggccttcttgaaaactcaaacggga
agctatcgcggccataatctggcaacgatcacagaagaagaagcaggcatattgccttct
aaataa

DBGET integrated database retrieval system