KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0232Help
Entry
Za10_0232         CDS       T01110                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Za10_0232
Enzymes [BR:zmn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Za10_0232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(273262..278265)
Genome map
AA seq 1667 aa AA seqDB search
MKRITGITLASSLAGAMMLGSLAVDPLPASVSKNPTPDNKTGATQTGATAGSGSAIQLLR
HQAIFWKNRGRNDLAANAWQRLLEIDPNNKMAKQALQESTFVPAAPESDSSPNNAPTKIV
TGQGGRSFPTGLTPSARAGRIRLEGFNAFKNNQLDIAEQRFRRALALYAHDKDALGGLGI
IRLKQHRYAEAIRYLEEASSDKEGYRWANALSSARFYGRFEEAQAASRANQLDKAQSILE
QLQNQQGGDANVSNALLADIYARQGQFDKAMALYDKLGNSADAVTVARLRSQENSIKARR
ALSQGDYAHAEQYFRTAIANDIANPWLRLDYARLLLKEGHRPEAVSLIRPLEDQASSEEA
IYAASLFWQEMGDNRHVISLIERIPDDARTPLINQIAESADINIALARAKRMSLYGRRGD
AIGLLRSLANDPNRSISQLGMIADGLLQLGDVEDAAFLAEHSLSLPLGEANDYQASLSVL
IRTGHYDTASDFISQIASEMSRHDQNGYKMLNRTLAIARADMMRQKKLYMPAFDVLHQAW
EETGGGDNILPVLARIYQDAGLTDKAQSLYHYMLRNHPRDASALLNSLTIAQQQGNDDRA
EQALRRLKKVAPGNPYVYLASARFEKSKSDDEQALKDLKKAHRVYQRMVRQGRSADLPSD
VANDDNSPIVVDAPNLPRDNYNPFALNEEDFRRLQTRSQVEMASSDSDADIDRDDYHYNR
DDYDDGFGQTSSYHSARSSGGNNDRFANGTSYQKPQQSAVKQPSGFSSHPLFASSDEENF
HNRSEEKPASRHSYSSRQGLAAADNTDYNEGRKAAHTVSSSSSKKTQTSQPLLANNFTST
QNALPFPNQTTGSRSSGNGLDSLNTRVFPDRNLSNDYDDEDERQEKIKRDMAEQRKYDSW
NIFAPGSAFGQSTMLEAPSYTSIAVADPINYPAAARLHGGSHDPLLRDINDGIDHLSLNT
GTVLEGTPEFRQHSGQNGLSRLNEYAFNAKVSTNLGSRVRGFFSVTPVYLTAGQPDKYAA
PYFGSNPLVSNASIAAGGKAMYAPVKDQSASGVALDAGIKIKDIRLDIGTTPIGFRKTNI
QGGVSWSPQIIDHLTGHIFMERRPVMDSLIAYAGTVDPVMGLTWGSVMKTGGGGGLSYDV
NGSGLYAQGNYRVYNGTRVQKNHAVEANVGGYYSLLNTPTSNFSIGVNVNYQHYLNNQYF
FSFAQGGYFSPNHFISVAFPLRYTGTLGRWKLNAELAPGYQNFYERSNYIFANEHDLQNQ
MNKFNLANNSLANKFPGQHHSGAGYEGRLAVSYRLSRSAVLGGEIRATTFGPYSEYRELL
SIHYAMDADKTDKHFILSTLVSVPLLVACRKGKAAEADNWTLFKSRFFKDGRISDSGNGN
ISHSEGQGYGMIQAEAAHDKATFDALWQWTKTHLMRPDMALFAWRFDPSQSNPVSDQNNA
TDGDILIAWALLRAEKRWPKNGYGQDSEAIRKSIGKKLVLSGGGETILLPGLQGFTGTDY
VILNFSYYIWPALKAFNEADNGAWHNVIESGKKLLAKAKFGLPQLPTDWVAFKNNGNLEP
AADKQPYFGFDAVRIPLYLIWGGEDALAAPFAIYWNSYLSHNQPVPAWVDVNSQAIAPYP
LSKGGMAILDLAMNKPITAKIADQDDYYSSALLALSEIAAKERPHNR
NT seq 5004 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcataacaggcattactctcgcttcctctctggctggtgccatgatgctggga
tccttggctgtggatcccttgccagccagcgtcagcaagaacccaacgccggataataaa
acgggcgcgacccaaacgggggcaaccgcaggcagtggtagtgcgatccagttattgcgt
catcaggcgattttctggaaaaatagaggccggaatgatcttgccgccaatgcgtggcag
agattgctcgaaattgaccctaataataaaatggccaaacaggccttgcaggaatcaacc
ttcgttccggcagcccctgaaagcgacagcagtcccaataatgcgccgaccaaaattgtt
actgggcagggtggccgttcttttccgacggggttaacgccttctgcacgagccggacgc
atccggcttgaaggctttaatgcgtttaaaaataatcagcttgatattgccgaacagcgt
tttagacgggctttagcgctttatgcccatgacaaggatgccttgggtggcttgggtatt
attcgcttaaaacaacatcgttatgctgaagccatccgttatttggaagaagcctcttct
gataaggaagggtatcgctgggcgaacgccttgtcttcggcgcgtttctatgggcgtttt
gaggaagcccaagcggctagccgagcaaaccagcttgacaaagcccagtccattttagag
caattacaaaatcagcagggcggcgatgcgaatgtttccaatgctctgttggctgatatc
tatgcgcgtcagggacaattcgacaaggcaatggcgctttatgataaattaggtaattct
gccgatgccgtgacagtggcccgtttacggagccaagaaaacagcatcaaagcacggcgc
gccttatcccaaggtgattatgcccatgcagagcagtatttcaggacagctattgccaat
gacattgccaatccatggttgcgtcttgattatgctcgactgttattaaaagaagggcat
cgcccagaggcagtcagtttaatacggcctttggaagaccaggcttcttctgaagaagcg
atttatgccgccagtctgttttggcaggaaatgggcgataatcgtcatgtcattagcttg
attgagcgtatccctgatgatgcccgcacgcctttgattaaccagattgctgaatctgcc
gatatcaatattgctttggcgcgtgcaaaacggatgagcctttatgggcggcgtggtgat
gccatcggtctgttgcgttctttggcgaatgatcccaatcgtagtatttcccagctgggt
atgattgccgatggcttattgcaattgggtgatgtcgaagatgcggcatttttagccgag
catagtttgtctttgcccttgggtgaggcgaatgactatcaagctagcctgtccgttctg
atccgaaccggccattatgatacagccagcgattttatcagccagattgcatctgagatg
tctcgtcatgaccagaatggttataagatgcttaaccgcaccttggcgattgctcgtgct
gatatgatgcgccagaaaaagctctatatgcctgcttttgatgtgttgcatcaggcttgg
gaagaaacgggtggcggcgataatattttgccagttttggctagaatttatcaggatgca
gggcttaccgataaagcgcaatcgctctaccattatatgttgcggaaccatccaagagat
gcgtcagctttgttgaacagtttaacgattgcgcaacagcaggggaatgatgaccgcgca
gagcaggctttacggcgcttgaagaaagtagcgcccggtaacccgtatgtttatttggcc
tctgctcgctttgaaaaatctaaaagtgatgatgagcaggccttaaaagacctgaaaaaa
gcgcatcgtgtttatcagagaatggtacggcaaggccggtcggctgatctaccttctgat
gtcgctaatgatgacaatagcccgattgttgtcgatgcgcccaatcttccgcgcgataat
tataatccttttgcgctcaatgaagaggatttccgtcgtttacagacccgcagtcaggtt
gaaatggcctcgtctgacagcgatgcggatatagatcgtgatgactatcattataatcgt
gacgattatgatgacggttttggacaaacatcgtcttatcattcggcgcggtcatctggc
ggaaataacgatcgttttgctaatggcacaagctatcaaaaaccccagcaatctgcggta
aaacagccatctggtttttcgtcccatcctttatttgcgtcttcggatgaagaaaacttc
cataatcgatccgaagaaaaaccagccagtcgccatagttatagcagcagacagggtttg
gcagctgcagataacaccgattataatgaaggacggaaagcggctcatacggtttcttca
tcttcatcgaaaaagacgcagacatcgcagcctttgctggccaataatttcacttcaacc
caaaatgctttacctttcccgaaccagacaacgggaagtcgttcttcaggtaatgggctt
gatagcctgaatacacgggttttccctgaccgcaacttgtcaaatgattacgatgacgag
gatgagcgtcaggaaaaaatcaaacgggacatggccgagcagcggaaatatgacagctgg
aatattttcgcgcccggtagcgcctttggtcaaagcacgatgttggaagcaccttcctat
acaagcatcgcggttgccgatccgattaactatccagccgccgcgcgcttgcatggtggt
agtcatgatccgttattgcgggatatcaatgacgggattgaccatctctctttgaatacc
ggaaccgttttggaaggcacacctgaattcaggcagcattccggtcagaatggcctcagc
cgtttaaatgaatatgctttcaatgccaaagtatccactaatctgggtagtcgggtaagg
ggcttcttctcggtaacgccggtttatttgaccgcaggccagccggataaatatgctgcg
ccttatttcggtagtaatccgttagtctctaacgccagtattgcggctggtggtaaggct
atgtacgctcccgtcaaagaccaatcggcttccggtgttgcccttgatgcgggtattaaa
atcaaagatatccgtctggatatcggtacaacccccattggcttcagaaaaaccaatatc
caaggcggtgtaagctggtcaccgcaaattatagaccatttgactggccatatctttatg
gaacgtcgtcctgtcatggacagcttgattgcttatgccggaacggtcgatcctgttatg
gggctgacatggggttccgtcatgaaaaccggtggcggtggtggtttatcctacgacgtc
aatggcagcggtctttatgcccaaggtaactatcgggtctataacggaaccagagttcag
aaaaaccatgcggttgaagccaatgtcggtggttattattcactcctgaacacgccaact
tctaatttcagcatcggcgtaaacgtcaattaccagcattatttgaataaccagtatttc
tttagctttgcgcaaggtggttatttcagtccgaaccactttatcagtgtggctttcccg
ctgcgctataccggaacgctgggacgctggaaattaaatgcagaattagcccctggctat
cagaacttctatgaaagaagtaactacatcttcgcgaatgagcatgatctgcaaaaccag
atgaacaaattcaatctcgcgaataatagtctggcgaataaattcccaggtcagcatcat
agtggtgccggttatgaaggtcgtctggctgtcagttacagattaagtcgttcggctgtt
ctgggtggcgaaattcgagcaacgacctttggtccttacagcgaatatcgtgaattactg
tctattcactacgcgatggatgctgataagacggataaacattttatcctttccactttg
gtaagcgtccctttgctggtagcctgtcggaagggtaaagcggccgaagctgataattgg
acattattcaagagtcgcttttttaaagatggccggatttcagatagcggtaatggaaat
atcagtcatagcgaaggacagggctatggcatgatacaagcagaagctgcccatgataaa
gcgacctttgatgctttgtggcagtggacaaaaacgcatctcatgcggcctgatatggcc
ctttttgcatggcgctttgatccgtcccaatccaatccggtatcagaccagaataatgcg
acggatggtgatattctgatcgcatgggctttattgcgtgcagaaaagcgttggccaaag
aacggttacgggcaggattccgaagcgattagaaaatctattggtaagaagctggttctt
tctggtggtggtgagaccattctgcttcccggcttacaggggtttaccggcactgattat
gttattctgaatttctcttattatatatggcctgcgttaaaagcctttaatgaggctgat
aacggggcttggcataatgttattgaaagcggaaaaaaattattggcaaaggctaaattc
ggtttgccacagttgcccactgattgggtcgctttcaaaaataacggcaatcttgaaccc
gccgccgacaagcaaccttatttcggttttgatgccgttagaatcccgctctatctgatt
tgggggggagaagatgccttggcagctccctttgctatttattggaatagctatctttcc
cataatcagcccgttccggcatgggtcgatgtgaatagccaagctattgcgccttatcct
ttatcaaaaggaggtatggctattcttgatctggcaatgaataaacccattaccgcgaaa
attgccgatcaggatgattattattcttcagctttattggctctttccgaaattgctgcg
aaagaaagaccgcataaccgctaa

DBGET integrated database retrieval system