KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0299Help
Entry
Za10_0299         CDS       T01110                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Za10_0299
Enzymes [BR:zmn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Za10_0299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(346043..347149)
Genome map
AA seq 368 aa AA seqDB search
MSFYNQNVSVPEMTDIRLYFCPTAFVNAPMAPSGATFRLAGGLKWFGAFSVIMVSKGEIV
QERVISVADINSFLNSLSTEMQLDAYRTISRIVAPRAAIQLGKSKIRLDHTHIVGILNVT
PDSFSDSGLYQDNVDAACDMAKAMMDQGASLIDIGGESTRPGAEAVSEEEEKLRVMPVIE
KLKEASLPISVDTRKSSVISAVWEQTPAIFNDVSALSWDKNSLFVAAEKSYPVILMHHEE
GSIHEGSSKKILIEVYNWLEKRIEVAEAAGISRDRIIIDPGIGFGKSFQDNLALIRGIAL
FHGLGCPLMLGASRKKLIITFAGDTHPQERLGGSLAIALHAADQGVQLLRVHDVRDTAQA
LTVWQALY
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtctttttataaccaaaatgtttcagtacctgaaatgaccgatatccgtctttatttt
tgtccgaccgcctttgtgaatgcaccgatggcgccttcgggtgcaacattccgtttggct
ggaggcttgaaatggtttggcgctttttccgttatcatggtttcaaaaggcgaaattgtt
caggaacgggtgatttctgttgcggatatcaatagctttttgaacagcctttcaacagaa
atgcagttggatgcctatagaaccatttcaaggattgtggcaccaagagcggctatccaa
ttaggtaaaagcaagatccggttagaccatacccatattgtcggtattttaaatgtgacg
cctgacagtttttcagatagcggtttatatcaagataacgttgatgcggcctgtgatatg
gccaaggcgatgatggatcagggcgcatctttgattgatatcggcggcgaatccacccgt
cccggagctgaagccgtatcagaagaagaggaaaaattgcgggtcatgccggtgattgag
aagctgaaagaggcttctctcccgatatcggttgacacccgaaaatcctcggtgatttcc
gctgtatgggaacagaccccggctatttttaatgatgtatctgctttgagttgggacaaa
aattctctctttgtcgcggcagaaaaatcttatcccgtcattttgatgcatcatgaagaa
ggctcaatccatgaagggtcttctaaaaaaattctgatcgaggtttataactggctcgaa
aagcgtatagaggttgcggaagcggccggtattagccgtgaccggatcattattgatccc
ggtatcggttttggtaaaagttttcaggataatcttgccttgatccgtggcattgccttg
ttccacggtttggggtgtcccttgatgctgggggcaagtcgtaaaaaactgattattacc
tttgcaggtgacacccatcctcaagaaagattgggcggctctttggcgattgcgcttcat
gcggccgatcagggtgtccaattattgcgcgtccatgatgtcagagatacggcgcaagcg
ctgactgtctggcaggctttatactaa

DBGET integrated database retrieval system