KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0406Help
Entry
Za10_0406         CDS       T01110                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:zmn00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:zmn00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
475349..476503
Genome map
AA seq 384 aa AA seqDB search
MYLCLGLSVPAAVITPTTAYSAASSVSLSSAPFGTTPEGQPVQIYTLKNANGVTVRFISY
GGIIQSIETPDRDGKAGDIVLGFSDLKGYTVDAAKGGLFFGALIGRYANRIANGTYSLGG
KTYHVPVTAAPNALHGGTRGFDKYVWTVRPLPATEHEAGAELTLVSPDNDQGFPGNLTVH
VTYTLNDKNELRLRYQAKTDKPTVLNLTNHSYFNLSGEGSGSIENQILKINADNYTPTDT
TSIPTGEIAPVAGTVLDFRNPMRIGDHLRDNNEQLRYARGYDQNWVINGEYGKQPRLAAQ
IFDPKTGRTMDVLTSQPGMQVYTSNSLDGTYYGKSNKQYRQTDAIAFEAEHFPDSPNHSN
FPTTELKPGQVFDYTTIFRFGTRR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtatttatgcctcggtttatctgtgccagcggcggttatcacaccgacaactgcctat
agcgctgcgtcttcggtcagtttaagtagtgcgccctttggcaccactcctgaaggccaa
cctgttcagatttacaccttaaaaaacgctaatggcgtaaccgttcgttttatttcttat
ggcggtatcatccaatccatcgaaacgcctgatcgcgatggtaaagccggtgatattgtt
ctcggattttccgatctcaaaggctacaccgtagatgcagcgaaaggcggcctctttttt
ggtgccttgattggtcgatatgccaaccggattgcgaatggtacttacagcctcggcggc
aaaacctatcatgtccccgtaaccgctgcgccgaatgccttacatggcggaacaaggggc
tttgataaatatgtttggacagtccgtcccctgcccgccaccgaacatgaggcgggtgca
gaattaactttggtcagccccgataatgaccaaggtttcccggggaatttaacggttcat
gtcacctatacattgaatgataaaaatgaattgcggctgcgttatcaggctaaaacggac
aagccgacggttctcaatctaaccaatcacagctattttaacttaagcggcgaaggctcc
ggttcgattgaaaaccagattttaaaaattaacgccgataactatacgccgacggatacg
acctctattcctactggcgagatagcccctgtagcaggcactgtccttgatttccgcaat
ccaatgcgaattggcgatcatttgcgcgataacaatgaacagctccgctatgcacgcgga
tatgatcagaattgggttattaacggggaatatggaaaacaacctcgcctcgcagcccaa
attttcgatcctaaaacgggacgaacaatggatgtgctgacatctcaaccggggatgcag
gtttatacctccaattctttggacggtacttattacggcaaaagcaacaaacaatatcgc
caaaccgacgctattgcttttgaagctgaacattttccagactcgcccaatcactccaat
ttcccgacaaccgaactcaaaccgggacaggtatttgattatacgacgattttccgcttt
ggaacgcgtcgttag

DBGET integrated database retrieval system