KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0413Help
Entry
Za10_0413         CDS       T01110                                 

Definition
CheA signal transduction histidine kinase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:zmn02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:zmn02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
481678..483351
Genome map
AA seq 557 aa AA seqDB search
MTQPEKKLFTLWQAQKKTIENDLKACQAGIYDSKCLLRLEMAIKELNNQASGNNETALVQ
LTFLLAQLIEAIRKDRLALNLFLIDLIQRSFDTIENYILAITSKQIPVDQTQIEEELQKT
IAHSSQYAIKKVGHEITIDKPEVILSKNALVADDPVTRIHQNATDEALHVEGSLEPHIPV
NPEKLDNLFDIFHEMLSIRSELSLTHGLSDEKAGRVNALEKLDQLIQSANNYAMALQTQT
IEPIFTQVIDIIKQRCGNNHKNIIFSVIGSEIKIDKRIVIDLGKALLELVDNAAFHGIEE
SETRQEMGKPREGHIRLEARYHASRLKIIIADDGRGILWEKLVKIAEQYGIIADKDTPDG
KADETQSFESHASHHGKGGFATVKDIVQSLKGEIRIYAPPRLGTRVTMLLPLNQTMVEGL
VTTVKDQSYILPISDIVESIAVNAEDIHWVDERQSMIQLRDQWFPAIALSALLGEENFTQ
DSFKTGRKILIRIDPTIHQPEVMIIVDALESQRQVLVQSLEKNFQAVHGISGVAFLQEGQ
TALVIDIDSLLNPHKYS
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcccgaaaaaaaactgtttactttatggcaagcccaaaaaaaaacgatcgaa
aatgatctaaaggcctgtcaggccggtatctatgacagcaaatgcctgctccgtttggaa
atggcgataaaagaactgaataatcaggcctctggcaataatgaaacagcgttagttcag
ttaacttttttactagcgcaactgatagaagcgatccgtaaagatcgcttggctttaaat
ctgttcttaattgatcttatccagcgtagttttgatacgatcgagaattacattctggcc
attacatcaaaacagattccggttgaccagacccagattgaagaagaattacaaaagaca
atcgcccattcttctcaatatgcgattaaaaaagtcggtcatgaaatcactatagacaag
ccagaagtcattttatccaaaaacgctctggtggccgatgatcccgtaacgcgtattcat
caaaatgccacagatgaagcgctccatgttgaaggcagtcttgaaccgcatattccagtt
aatcctgaaaaactggataatctattcgatatattccacgaaatgctgagcattcgttca
gaattaagtctcactcatggcctttcagatgaaaaagctggtcgggtcaatgcgctcgaa
aaattagatcaactaatccaatctgccaataattatgctatggcgctccaaactcagact
atcgagccgatttttacacaagtcattgatatcattaagcaaagatgcggtaataatcac
aaaaatatcattttttcagttatcggatctgaaatcaaaatcgacaaacggatcgtcatt
gatcttggcaaggctttacttgaacttgtcgataatgcggcctttcacggcattgaagaa
agcgaaacacgtcaggaaatgggtaaacctcgcgaaggtcatattcgcttggaagcccgc
tatcatgccagccgcttaaagatcattatcgccgatgatggccgtggcattctttgggaa
aaactggtcaaaatcgccgaacaatacggcataattgcagataaagatactccagatggg
aaagcagacgaaacgcaatcttttgaaagccatgcctcgcatcatggaaaaggcggcttt
gcgaccgtcaaagacattgttcagtctttaaagggagaaatacgcatttatgcccctccc
cgtttaggcacgcgggtcacgatgcttctaccccttaatcaaacgatggttgaaggcctg
gttaccaccgtcaaagatcaaagctatatcctgcctatctccgatatcgtcgaaagcatc
gcggtcaacgcagaagatattcattgggtcgatgaaagacagtcgatgatccaactacgg
gatcaatggtttccggctattgcgctttctgccttattaggagaggaaaatttcacacag
gattcttttaagacaggccgaaaaatcctgatcagaattgacccgacgattcaccaacca
gaagtgatgattatcgttgatgctcttgaaagccaaagacaggttttagttcaaagcctc
gaaaaaaatttccaagctgtgcacggtattagtggggttgcttttctacaagaaggtcaa
acggctctagttattgacatagactccttattaaaccctcacaaatacagttaa

DBGET integrated database retrieval system