KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0413Help
Entry
Za10_0413         CDS       T01110                                 

Definition
CheA signal transduction histidine kinase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Za10_0413
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Za10_0413
Enzymes [BR:zmn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Za10_0413
Two-component system [BR:zmn02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Za10_0413
Bacterial motility proteins [BR:zmn02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Za10_0413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
481678..483351
Genome map
AA seq 557 aa AA seqDB search
MTQPEKKLFTLWQAQKKTIENDLKACQAGIYDSKCLLRLEMAIKELNNQASGNNETALVQ
LTFLLAQLIEAIRKDRLALNLFLIDLIQRSFDTIENYILAITSKQIPVDQTQIEEELQKT
IAHSSQYAIKKVGHEITIDKPEVILSKNALVADDPVTRIHQNATDEALHVEGSLEPHIPV
NPEKLDNLFDIFHEMLSIRSELSLTHGLSDEKAGRVNALEKLDQLIQSANNYAMALQTQT
IEPIFTQVIDIIKQRCGNNHKNIIFSVIGSEIKIDKRIVIDLGKALLELVDNAAFHGIEE
SETRQEMGKPREGHIRLEARYHASRLKIIIADDGRGILWEKLVKIAEQYGIIADKDTPDG
KADETQSFESHASHHGKGGFATVKDIVQSLKGEIRIYAPPRLGTRVTMLLPLNQTMVEGL
VTTVKDQSYILPISDIVESIAVNAEDIHWVDERQSMIQLRDQWFPAIALSALLGEENFTQ
DSFKTGRKILIRIDPTIHQPEVMIIVDALESQRQVLVQSLEKNFQAVHGISGVAFLQEGQ
TALVIDIDSLLNPHKYS
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcccgaaaaaaaactgtttactttatggcaagcccaaaaaaaaacgatcgaa
aatgatctaaaggcctgtcaggccggtatctatgacagcaaatgcctgctccgtttggaa
atggcgataaaagaactgaataatcaggcctctggcaataatgaaacagcgttagttcag
ttaacttttttactagcgcaactgatagaagcgatccgtaaagatcgcttggctttaaat
ctgttcttaattgatcttatccagcgtagttttgatacgatcgagaattacattctggcc
attacatcaaaacagattccggttgaccagacccagattgaagaagaattacaaaagaca
atcgcccattcttctcaatatgcgattaaaaaagtcggtcatgaaatcactatagacaag
ccagaagtcattttatccaaaaacgctctggtggccgatgatcccgtaacgcgtattcat
caaaatgccacagatgaagcgctccatgttgaaggcagtcttgaaccgcatattccagtt
aatcctgaaaaactggataatctattcgatatattccacgaaatgctgagcattcgttca
gaattaagtctcactcatggcctttcagatgaaaaagctggtcgggtcaatgcgctcgaa
aaattagatcaactaatccaatctgccaataattatgctatggcgctccaaactcagact
atcgagccgatttttacacaagtcattgatatcattaagcaaagatgcggtaataatcac
aaaaatatcattttttcagttatcggatctgaaatcaaaatcgacaaacggatcgtcatt
gatcttggcaaggctttacttgaacttgtcgataatgcggcctttcacggcattgaagaa
agcgaaacacgtcaggaaatgggtaaacctcgcgaaggtcatattcgcttggaagcccgc
tatcatgccagccgcttaaagatcattatcgccgatgatggccgtggcattctttgggaa
aaactggtcaaaatcgccgaacaatacggcataattgcagataaagatactccagatggg
aaagcagacgaaacgcaatcttttgaaagccatgcctcgcatcatggaaaaggcggcttt
gcgaccgtcaaagacattgttcagtctttaaagggagaaatacgcatttatgcccctccc
cgtttaggcacgcgggtcacgatgcttctaccccttaatcaaacgatggttgaaggcctg
gttaccaccgtcaaagatcaaagctatatcctgcctatctccgatatcgtcgaaagcatc
gcggtcaacgcagaagatattcattgggtcgatgaaagacagtcgatgatccaactacgg
gatcaatggtttccggctattgcgctttctgccttattaggagaggaaaatttcacacag
gattcttttaagacaggccgaaaaatcctgatcagaattgacccgacgattcaccaacca
gaagtgatgattatcgttgatgctcttgaaagccaaagacaggttttagttcaaagcctc
gaaaaaaatttccaagctgtgcacggtattagtggggttgcttttctacaagaaggtcaa
acggctctagttattgacatagactccttattaaaccctcacaaatacagttaa

DBGET integrated database retrieval system