KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0425Help
Entry
Za10_0425         CDS       T01110                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Brite
Enzymes [BR:zmn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Za10_0425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(495244..496257)
Genome map
AA seq 337 aa AA seqDB search
MQDHNQVNKEKPVLVTGVSGFVGSAVARSLAQQGYKVRGMVRATSPKTNIRDFPGEIVFG
DLDDPPSLREPLSGCGALIHVAADYRLWAADPNEIIRHNRLHTQAIMTAALYLGIERVIY
TSSVATLAPGHGKPSDENSPLTPENAIGAYKRSKVEAERLVEKMIAEQGLPAVIVNPSTP
IGPRDVKPTPTGRIIIEAATGKMPAYVNTGLNLAHVDDVADGHVKALEKGVIGERYILGG
ADVPLSVMLAEIARQVGRKPPKVALPRWLLFPLAWGAEAFAKITKKEPFITSDALRMAGY
HMYFSSEKAKRDLGYKSRPWQHAISDAIEWFRAEGML
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagatcataatcaggtgaacaaagagaagcctgtattagttactggagtttctgga
tttgtgggttctgcggttgcgcgttcattagcgcagcagggctataaagtgcgaggcatg
gtacgtgcgaccagcccgaaaaccaatatccgtgactttcccggcgagattgtttttggt
gatctggatgatccgccttctttaagagaacccctttcaggctgtggcgcgctgatccat
gtagcagctgattatcgtttatgggccgccgatcctaacgaaattattcgtcataaccgt
ttgcatacccaagcgatcatgacagcggcactctatctgggtatcgagcgcgtgatctat
accagtagtgtcgctaccttggcaccgggacatggtaaacccagcgatgagaattctccg
ctaacgccggaaaatgctattggtgcctataaacgttccaaggttgaagccgaacgtctg
gttgaaaagatgatagcagagcagggcttgcctgcggttattgttaatccttcaacgcct
attggcccaagggatgttaagcctacgcccaccggacgtattattatcgaagcggctacc
ggaaaaatgcccgcctatgtcaatacagggcttaatcttgctcatgtggatgacgtagca
gatgggcatgttaaagcccttgaaaaaggcgttatcggtgaaaggtatattttaggcggc
gccgatgtgcctttaagtgtcatgttggctgaaatcgcgcgacaggtaggtcggaagcca
ccaaaagtcgctttgccaagatggctgctctttccattggcatggggcgcagaagccttt
gccaagataacgaaaaaagaacctttcattaccagtgatgccttgcgcatggctggctat
catatgtatttttcgtcggagaaagccaaacgcgatctgggttacaaatcccgtccatgg
caacatgccatttctgatgccatcgaatggtttcgggcagaaggtatgttgtga

DBGET integrated database retrieval system