KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0462Help
Entry
Za10_0462         CDS       T01110                                 

Definition
(GenBank) UDP-N-acetylmuramyl-tripeptide synthetase
  KO
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Za10_0462
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Za10_0462
Enzymes [BR:zmn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Za10_0462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(542368..543828)
Genome map
AA seq 486 aa AA seqDB search
MSGTEKKLGFLASGYGLSPKEKDYPVLGFAVDSRKVEKGFVFGAFPGAKVNGEDFIEKAI
AAGAVAIVARPEVKIEGAVHLVAENPRLAFAEMAARFYAPFPPVMAAVTGTNGKTSVAEL
CRQFWMIAGHKAASIGTLGVITAENSYSLGMTTPDVVTFLSCCSDLARADISHVIFEASS
HGLDQYRSDGAKVIAGAFTSFSRDHLDYHGTMERYLAAKLRLFDERIAPDGTAVVWADDP
AAKTVIAHVQKRGLKLIDIGEKAEAIRLVNREADSQGQMITLSIQGESYKIRLPLIGGYQ
LSNALVAAGLVLATGGDIKQTMAALTLLKPVRGRLERATQSQNGAEVYVDYAHTPDGLRA
AIEALRPHTEGRLWVVFGAGGDRDKGKRPEMGKIAANLADHVIVTDDNPRGEDAATIRKE
ILVGAPLAEEIGGRKEAIFSAIKRAEKGDIVLIAGKGHEQGQIIGRGETMRVLPFDDVTV
AKEAVL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcacagaaaaaaaactgggatttttggcctccggttacggacttagcccaaaa
gaaaaagactatcctgttcttggttttgcggtggatagccgtaaggttgagaagggtttt
gtttttggtgcttttcccggagccaaagtgaatggcgaagattttatagaaaaggcaata
gctgccggtgccgtcgccattgttgcacgccccgaagtcaaaattgagggtgcggttcat
ttggtagccgaaaatcctcgattggcttttgctgaaatggccgcccgtttttatgcgcct
ttcccgcctgttatggctgcggtaacgggcacgaatggcaaaacatcggttgcagaatta
tgccgtcagttttggatgatagcgggtcataaagcggcatcaatcgggactttgggcgtt
attactgcggaaaacagctattcgctgggaatgacaacgccggatgttgtgacctttctt
tcttgctgttccgatttagcgcgtgcggatatttctcatgtgatttttgaagcctccagc
cacggtcttgaccaatatcgaagtgatggagcgaaagtgatagcgggcgcatttaccagt
ttttctcgcgatcatcttgattatcacgggacaatggaacgctatcttgccgccaaactg
cgtctatttgatgagcgtattgcacccgatggcacggctgtcgtttgggctgatgatccg
gcagccaagacggttattgcccatgtccaaaaacgtggtctaaaattaatagatattgga
gaaaaagccgaggctatccgcctcgttaatcgagaagctgatagtcagggacagatgatt
accctgtcgattcaaggtgaaagctataaaattcgactgcctttgatcggtggatatcag
ctatccaatgctttggtcgcagccggattagttctggccacgggaggtgacatcaagcag
acgatggcggctcttactttactaaaacctgttcgaggccggctggaaagagcaacccaa
agccaaaatggcgcggaagtctatgttgattatgcccatacgcctgatggcttgagagct
gcgattgaagccttgcggcctcatactgaagggcggctttgggtcgtttttggtgcaggc
ggcgaccgtgataaaggcaaaaggccagaaatgggtaaaattgccgccaatcttgccgat
catgttattgtaaccgacgataatcctcgtggtgaggatgcggcgactatccgaaaagaa
attctggtaggagcgcccctggcagaagaaataggtggacggaaagaagctattttttct
gctatcaagcgagccgaaaagggcgacattgttttgatcgcgggaaaagggcatgagcaa
ggccagattatcggccgtggagagactatgcgggttctaccttttgatgatgtgactgtc
gccaaagaggctgtattatga

DBGET integrated database retrieval system