KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0474Help
Entry
Za10_0474         CDS       T01110                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Za10_0474
DNA repair and recombination proteins [BR:zmn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Za10_0474
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Za10_0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(557023..557619)
Genome map
AA seq 198 aa AA seqDB search
MSASPIENLIKSLAVMPGLGPRSARRAALYLIKKRETALYNLAQALDEVQQSLVICPECG
NIDSCNPCSICSDPKRDDALLCVVEEVADLWALDRSRLFAGRFHVLGGRLSALDGITPED
LSIDALVKRVQSGKIKEVVLAMNATLEGQTTAHYITDCLEKYPVRITQLAHGLPVGGELD
YLDDGTLAQALRARRPVS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttctcctatagaaaatcttatcaagagtctggctgttatgcccggattgggc
ccgcgatcagcaaggcgggcggcgttgtatctgattaaaaagagagaaaccgcactttat
aatctggcgcaggctttggatgaggtgcagcagtcgctggttatctgccccgaatgtggc
aatattgatagctgcaatccttgttcgatctgttccgaccccaagcgggatgatgcctta
ctgtgtgtggttgaagaggttgctgatttatgggcgcttgatcggtcacgtctatttgcg
ggacgctttcatgtccttggcgggcggttatcggccttggatgggataacgcccgaagat
ctgtcgattgatgcccttgtgaagcgggttcaatcgggaaaaattaaagaggttgtcttg
gccatgaatgccacgttagaaggccagacgaccgcgcattatataacggattgtttagaa
aaatatccggtaagaattacccaattggcgcatggtcttcctgtaggaggggagcttgac
tatttagatgatggcactttagcgcaagctttgcgtgccagacgacctgtatcatga

DBGET integrated database retrieval system