KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0474Help
Entry
Za10_0474         CDS       T01110                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Za10_0474 (recR)
DNA repair and recombination proteins [BR:zmn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Za10_0474 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(557023..557619)
Genome map
AA seq 198 aa AA seqDB search
MSASPIENLIKSLAVMPGLGPRSARRAALYLIKKRETALYNLAQALDEVQQSLVICPECG
NIDSCNPCSICSDPKRDDALLCVVEEVADLWALDRSRLFAGRFHVLGGRLSALDGITPED
LSIDALVKRVQSGKIKEVVLAMNATLEGQTTAHYITDCLEKYPVRITQLAHGLPVGGELD
YLDDGTLAQALRARRPVS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttctcctatagaaaatcttatcaagagtctggctgttatgcccggattgggc
ccgcgatcagcaaggcgggcggcgttgtatctgattaaaaagagagaaaccgcactttat
aatctggcgcaggctttggatgaggtgcagcagtcgctggttatctgccccgaatgtggc
aatattgatagctgcaatccttgttcgatctgttccgaccccaagcgggatgatgcctta
ctgtgtgtggttgaagaggttgctgatttatgggcgcttgatcggtcacgtctatttgcg
ggacgctttcatgtccttggcgggcggttatcggccttggatgggataacgcccgaagat
ctgtcgattgatgcccttgtgaagcgggttcaatcgggaaaaattaaagaggttgtcttg
gccatgaatgccacgttagaaggccagacgaccgcgcattatataacggattgtttagaa
aaatatccggtaagaattacccaattggcgcatggtcttcctgtaggaggggagcttgac
tatttagatgatggcactttagcgcaagctttgcgtgccagacgacctgtatcatga

DBGET integrated database retrieval system