KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0474Help
Entry
Za10_0474         CDS       T01110                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:zmn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(557023..557619)
Genome map
AA seq 198 aa AA seqDB search
MSASPIENLIKSLAVMPGLGPRSARRAALYLIKKRETALYNLAQALDEVQQSLVICPECG
NIDSCNPCSICSDPKRDDALLCVVEEVADLWALDRSRLFAGRFHVLGGRLSALDGITPED
LSIDALVKRVQSGKIKEVVLAMNATLEGQTTAHYITDCLEKYPVRITQLAHGLPVGGELD
YLDDGTLAQALRARRPVS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttctcctatagaaaatcttatcaagagtctggctgttatgcccggattgggc
ccgcgatcagcaaggcgggcggcgttgtatctgattaaaaagagagaaaccgcactttat
aatctggcgcaggctttggatgaggtgcagcagtcgctggttatctgccccgaatgtggc
aatattgatagctgcaatccttgttcgatctgttccgaccccaagcgggatgatgcctta
ctgtgtgtggttgaagaggttgctgatttatgggcgcttgatcggtcacgtctatttgcg
ggacgctttcatgtccttggcgggcggttatcggccttggatgggataacgcccgaagat
ctgtcgattgatgcccttgtgaagcgggttcaatcgggaaaaattaaagaggttgtcttg
gccatgaatgccacgttagaaggccagacgaccgcgcattatataacggattgtttagaa
aaatatccggtaagaattacccaattggcgcatggtcttcctgtaggaggggagcttgac
tatttagatgatggcactttagcgcaagctttgcgtgccagacgacctgtatcatga

DBGET integrated database retrieval system