KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0540Help
Entry
Za10_0540         CDS       T01110                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Za10_0540
Enzymes [BR:zmn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Za10_0540
Transfer RNA biogenesis [BR:zmn03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Za10_0540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(636424..637242)
Genome map
AA seq 272 aa AA seqDB search
MLLSSLSPQAALLEGLVQIALQAGKRALEIYHGDFTVMKKDDDSPVTQADREAEAIILQG
LKKLQPGVAVIAEEEYAKTKKGYNTDSFFLVDPIDGTQEFVNKRDEFTVNIALIKKAYPI
LGVIYAPAINRLYVGDVLAKTAWAADTTEDFQIENRNSIQIREAGEKWDVMTSFSHNNPA
TEAYLKQLPIENRIKAGSSLKLCLLAEGKADIYPRLSPTHEWDTAAGHAILLAAGGNVID
ETGENLTYGKPGYRNPGFIAYGSEQPPLPVEK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcttttatcatcactttcgccgcaggctgcgttattagaaggtctggtacaaattgcg
ctacaggccggaaaacgggcgctcgaaatttatcatggtgatttcaccgtgatgaagaaa
gatgacgatagccccgtaacgcaggcggatcgggaagctgaagcgattattttacaggga
ttgaaaaagctgcaacccggtgttgccgtcatcgcagaagaagaatatgccaaaaccaag
aaggggtataataccgacagctttttcttggttgatcccattgatggcacgcaggaattt
gtgaataagcgtgatgaattcacggtcaatattgccttgattaaaaaggcctatcctatt
ttaggggtgatctatgcgccggcaatcaaccgtctttatgtcggcgatgtgttggctaaa
acggcatgggccgctgatacgactgaagatttccagattgaaaaccggaatagcattcaa
atccgtgaagcgggtgaaaaatgggatgtgatgacctctttttcccataataaccctgca
accgaggcctatttgaagcaattaccgatcgaaaatcggattaaggccggttcttctttg
aaattatgtttattggcagaaggaaaagcggacatctatcctcggttatcgcctacccat
gagtgggatacggctgcgggtcatgccattcttttggccgcagggggtaatgtgatcgac
gaaacgggtgaaaatctgacctatgggaaaccgggttatcgcaaccccggttttatcgcc
tatggatcggagcagccgcctttacctgtagaaaaataa

DBGET integrated database retrieval system