KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0672Help
Entry
Za10_0672         CDS       T01110                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
zmn00260  Glycine, serine and threonine metabolism
zmn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zmn01100  Metabolic pathways
zmn01110  Biosynthesis of secondary metabolites
zmn01130  Biosynthesis of antibiotics
zmn01230  Biosynthesis of amino acids
Module
zmn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Za10_0672
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Za10_0672
Enzymes [BR:zmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Za10_0672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACV75219
JGI: Za10_0672
Position
784671..785897
Genome map
AA seq 408 aa AA seqDB search
MKQSNSVLPNSLRAQPDAGGHFGTFGGQYVPETLMPLILELNQEYRRALKDPSFIAERDD
LLEHYVGRPSPLYFAPRLTEAWGGAKIYLKREDLNHTGAHKINNCIGQVLLAKRMGKTRV
IAETGAGQHGVATATVAARFGLSCTVFMGELDTERQQPNVFRMKLLGAEVRPVKAGSRTL
KDAMNEALRDWVAHIDDTFYILGTAAGPHPYPEMVRDFQSVIGREAREQIQKAEKRLPDL
LIAAVGGGSNAMGLFHPFLDDTDVAMIGVEAAGEGMETGRHAASLTGGAPGIVHGNRTYL
LYDENGQIKDAHSISAGLDYPGIGPEHSWLKDIKRVRYETITDNEALAAFQQLCRLEGII
PALESSHALAEAAKIAPTMGKDKVIIVNLSGRGDKDIYTVASHLGVAL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatctaattctgttcttccgaattctcttcgcgcccaacctgatgcaggaggg
cattttggcacattcggcggacaatatgttcccgaaaccctgatgcctttaattcttgag
cttaatcaggaatatcggcgcgcattgaaagacccgtcattcatagcagaaagagatgat
ctgctagagcattatgtcggtcgtcctagcccgctttatttcgcgcctcgcctgacagaa
gcctggggcggcgcaaaaatctatttgaagcgtgaagatcttaatcacacgggtgcgcat
aaaatcaataactgcatcggtcaggtcttattagcgaaaagaatgggtaaaacccgcgtt
atcgcggaaaccggtgccggacagcatggtgtcgcgacggcgaccgttgcggctcgtttt
ggtctatcttgcacagtctttatgggtgaactggatacagagcgccagcaacccaatgtc
tttagaatgaaattgttaggtgccgaggttcgtcccgttaaggcgggttcccgcaccttg
aaagatgccatgaatgaagccctgcgtgattgggtggctcatattgatgacactttctat
attcttggcacggcagcaggcccccatccctatcctgaaatggtgcgtgatttccaatcc
gtgattggacgcgaagccagagagcagattcaaaaagcagaaaagcgtttaccggattta
ttgatcgcagccgttggcggtggatcaaatgctatggggcttttccatcctttccttgat
gatacagatgtcgctatgattggtgtcgaggccgccggtgaaggtatggaaaccggtcgt
catgcagctagcttaacgggcggcgcaccgggtatcgtccatggaaaccgcacctatctt
ctttatgatgagaatggtcagattaaagatgcccattcgatttcagccggtcttgattat
ccgggtattggccctgaacatagctggttaaaagacataaaacgtgtccgttatgaaacc
attacggataacgaagccttggccgctttccagcagctttgccgattagagggcattatt
ccggcattggaatcttcccatgctttggccgaagccgccaaaatagccccgacaatgggc
aaagacaaagtcattattgttaatctttcagggcgtggcgacaaagatatctataccgta
gccagccatttaggggtcgcgttatga

DBGET integrated database retrieval system