KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0673Help
Entry
Za10_0673         CDS       T01110                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Za10_0673 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Za10_0673 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Za10_0673 (trpA)
Enzymes [BR:zmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Za10_0673 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
785894..786718
Genome map
AA seq 274 aa AA seqDB search
MSRIANTFAKTKKENRAALIAFLTAGDPSIEATPALLDSLVENGVDIIELGMPFSDPMAD
GPAIQKANLRALAAKTGYNDIFRIATEFRKRHPETPLILMGYANPMTFKGSDSFAASAKE
AGVDGIICVDIPPEEDATLGVAVREKGMDMIRLATPTSDEARLKIILDGASGFLYYVSVA
GVTGLQQATEASIDAALDRIKAVTDLPVAVGFGIRSPEQAAAIAKKADAVVVGSAFVSCI
EKAVTNRQDPNAALEKLAKELSTAISDARKEAAL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagccggattgccaatacttttgccaaaacaaaaaaagaaaatcgggctgctttgatt
gcctttctgacagcaggtgatccctctattgaagcgacccctgccctgttggatagtctg
gttgaaaatggcgtcgatattatcgaattagggatgcccttttctgatccgatggcagat
ggccccgctattcagaaagccaatcttcgggctttggcggctaaaactggctataatgac
atctttagaatagccacggaatttagaaaacgacatccggaaacgccgcttatccttatg
ggatatgccaatccgatgacgtttaaaggcagcgacagcttcgctgcttctgcaaaagaa
gccggtgttgacggcattatctgtgtcgatattccgccagaagaagacgcaacccttggt
gtcgcagtgcgcgaaaaaggcatggatatgatccggctcgccaccccgaccagcgatgaa
gcgcgtttaaaaatcatcctcgatggggcttccggtttcctctattatgtttctgtcgcg
ggcgttacgggtctgcaacaggcaactgaagccagcattgatgccgcgcttgatcggatt
aaagctgtaacagatttgccggttgccgtcggtttcggtattcgttcaccagaacaggcc
gcagcgattgccaaaaaggctgatgcggttgtggtggggtcggcctttgtgtcttgcatc
gaaaaggctgtgaccaatcgccaagatcccaatgcagccttagagaaattggctaaagaa
ttaagcacggccatttccgatgcccgtaaggaggccgccctatga

DBGET integrated database retrieval system