KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0673Help
Entry
Za10_0673         CDS       T01110                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
zmn00260  Glycine, serine and threonine metabolism
zmn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zmn01100  Metabolic pathways
zmn01110  Biosynthesis of secondary metabolites
zmn01130  Biosynthesis of antibiotics
zmn01230  Biosynthesis of amino acids
Module
zmn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Za10_0673
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Za10_0673
Enzymes [BR:zmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Za10_0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB DUF2092
Motif
Other DBs
NCBI-ProteinID: ACV75220
JGI: Za10_0673
Position
785894..786718
Genome map
AA seq 274 aa AA seqDB search
MSRIANTFAKTKKENRAALIAFLTAGDPSIEATPALLDSLVENGVDIIELGMPFSDPMAD
GPAIQKANLRALAAKTGYNDIFRIATEFRKRHPETPLILMGYANPMTFKGSDSFAASAKE
AGVDGIICVDIPPEEDATLGVAVREKGMDMIRLATPTSDEARLKIILDGASGFLYYVSVA
GVTGLQQATEASIDAALDRIKAVTDLPVAVGFGIRSPEQAAAIAKKADAVVVGSAFVSCI
EKAVTNRQDPNAALEKLAKELSTAISDARKEAAL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagccggattgccaatacttttgccaaaacaaaaaaagaaaatcgggctgctttgatt
gcctttctgacagcaggtgatccctctattgaagcgacccctgccctgttggatagtctg
gttgaaaatggcgtcgatattatcgaattagggatgcccttttctgatccgatggcagat
ggccccgctattcagaaagccaatcttcgggctttggcggctaaaactggctataatgac
atctttagaatagccacggaatttagaaaacgacatccggaaacgccgcttatccttatg
ggatatgccaatccgatgacgtttaaaggcagcgacagcttcgctgcttctgcaaaagaa
gccggtgttgacggcattatctgtgtcgatattccgccagaagaagacgcaacccttggt
gtcgcagtgcgcgaaaaaggcatggatatgatccggctcgccaccccgaccagcgatgaa
gcgcgtttaaaaatcatcctcgatggggcttccggtttcctctattatgtttctgtcgcg
ggcgttacgggtctgcaacaggcaactgaagccagcattgatgccgcgcttgatcggatt
aaagctgtaacagatttgccggttgccgtcggtttcggtattcgttcaccagaacaggcc
gcagcgattgccaaaaaggctgatgcggttgtggtggggtcggcctttgtgtcttgcatc
gaaaaggctgtgaccaatcgccaagatcccaatgcagccttagagaaattggctaaagaa
ttaagcacggccatttccgatgcccgtaaggaggccgccctatga

DBGET integrated database retrieval system