KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0686Help
Entry
Za10_0686         CDS       T01110                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Za10_0686
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Za10_0686
   00650 Butanoate metabolism
    Za10_0686
  Energy metabolism
   00190 Oxidative phosphorylation
    Za10_0686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
802912..803298
Genome map
AA seq 128 aa AA seqDB search
MMNSYSDSPLSGNHRYRDSHRTDFYKKLTAAANLLLYVWLIVSFLELPVYDFNVIRRWVA
QTIVALPMIFLAISTYGYACSFVDKLFSEERFPKAGLYFQIAAYFYMIIFAAIAVFSILK
IAFHSGIS
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgatgaattcttacagtgacagcccgctatctggaaatcaccgttatcgtgatagccat
cgaaccgatttttataaaaaactcacggcggcggctaatcttcttttatatgtttggttg
atcgtctcttttctggaattaccggtctatgattttaatgtcattagacgttgggtagcc
cagaccatagtcgccttgccgatgatttttctggccatatcgacctatggctatgcctgc
tcttttgtggataagctgttttcagaggagcgttttccaaaagcagggctgtatttccag
atagccgcctatttttacatgataatttttgcagcaatcgcggtcttttcaattctgaaa
atcgcttttcattctggtataagctaa

DBGET integrated database retrieval system