KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0708Help
Entry
Za10_0708         CDS       T01110                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Za10_0708
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Za10_0708
Enzymes [BR:zmn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Za10_0708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
830605..831399
Genome map
AA seq 264 aa AA seqDB search
MSNILTEICATKAEFVAERKKQIGNNALLDLIKAQTQPRGFRAALEKKRARGQFGLIAEI
KKASPSKGLIRSDFTPAAHARDYEEGGAACLSVLTDRPYFQGHEDYLIAARKAVKLPVLR
KDFMIDPWQVTEARAIGADAILIIVAALDDQQMQDIEAAALEYGMDALVEVHSHDEMERA
LKLKSRLIGVNNRDLRDFSVSFDRTYELVGSAPKDCTFVAESGIRNHDDLVAMQRHDIGC
FLVGETLMRQDDLRKATKDLLGLS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatattcttacagagatctgcgccaccaaggcagaattcgtggcagaacgaaaa
aaacagattgggaataatgcccttcttgatttgataaaggcacagacgcaacctcgtggt
tttcgagctgccctagaaaaaaagagagcgcgagggcaattcgggcttattgcagaaatc
aaaaaagctagcccttcaaaagggttaatccgttctgattttacaccagcagcccatgcc
cgtgactatgaagaaggcggtgcagcctgtttatccgttttaacagatcgcccctatttc
caaggccatgaagattatttaatcgcggccagaaaagcagtaaaattacccgtccttcgt
aaagattttatgattgacccgtggcaggtaaccgaagctagagccatcggtgccgatgcg
atcttgattatcgttgcggccttggatgatcagcagatgcaggatattgaagccgccgct
ttggaatatggcatggatgctttggtagaagtccatagtcatgatgagatggagcgggcg
ttaaaattgaaatcccgtcttattggcgtcaataatcgcgatttgcgagacttttcggtc
agttttgaccgcacctatgaattagtgggttcagcccccaaagattgcacctttgttgcg
gaaagcggtatccgcaatcatgatgatttggtagctatgcagcgtcatgacattggctgt
tttttagtaggtgaaactttaatgcggcaagatgatctgagaaaagccacaaaggattta
ttgggattatcctaa

DBGET integrated database retrieval system