KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0787Help
Entry
Za10_0787         CDS       T01110                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Za10_0787
   01230 Biosynthesis of amino acids
    Za10_0787
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Za10_0787
   00051 Fructose and mannose metabolism
    Za10_0787
   00562 Inositol phosphate metabolism
    Za10_0787
Enzymes [BR:zmn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Za10_0787
Exosome [BR:zmn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Za10_0787
  Exosomal proteins of bladder cancer cells
   Za10_0787
  Exosomal proteins of melanoma cells
   Za10_0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
910551..911300
Genome map
AA seq 249 aa AA seqDB search
MTIRKLIAGNWKMNGSLGMLHELDGIAKATFNHPELDVVICPSFTLIAPAIVRQPDMTFG
AQDCHYDESGSHTGCVSAPMLREVGASYVIVGHSERRIEQNETNEEIRAKTTTAIANGLV
TIVCIGESRAAHASGQALPIIGAQLDGCIPPDATSDNLVVAYEPIWAIGTGNTPPPESIA
EMHASIRDRLCLLLGSEGKKVRILYGGSVTGKNAEELMAIPDVNGTLVGGASLTAEQFVP
IIEAGGRLA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacaatacgcaagctcatcgccggcaattggaaaatgaacggttctttaggcatgttg
cacgaactggacgggatcgccaaggcaacctttaaccatccagaacttgatgtcgtgatt
tgtccatccttcacgctgatagcgcccgctattgtgcggcaacccgatatgaccttcggg
gcgcaagattgccattatgatgaaagtggttcgcataccggctgtgtttcggcaccgatg
ctccgtgaagtcggtgcaagttatgtcatcgttggccatagcgaaagacgtattgaacag
aatgaaaccaatgaagagatccgagcaaaaacgacaacggcgatagccaatggtcttgtg
acgattgtttgtattggcgaatcccgtgctgcccacgcatcggggcaggctttgcctatt
atcggggcgcagctggatggctgtattccgccagatgccaccagcgataatctagttgtt
gcctatgaacccatctgggctatcggaacggggaataccccaccgcctgaaagcattgcc
gaaatgcatgcctcgattcgtgaccgcttgtgcctgttattaggaagcgaagggaagaag
gtccgcatcttatatggaggctctgttaccggcaaaaatgccgaagaattgatggccatt
ccagatgtcaatggaacccttgtcggtggtgccagccttaccgcagaacaatttgttcct
atcattgaagctgggggacgtttagcctag

DBGET integrated database retrieval system