KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0815Help
Entry
Za10_0815         CDS       T01110                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Za10_0815
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Za10_0815
Enzymes [BR:zmn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Za10_0815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
937240..938112
Genome map
AA seq 290 aa AA seqDB search
MSSINKPLRLIFPQWQGGDNPPYYLGSQLLAWLSPDPKGAVEEVPVPKPTGEPLQEENGI
VGRSILIDQLSKARQLIEKHTPDSLVVLGGDCLVSLAPFSWLLEKYKDKLGILWIDSHPD
VQTPKEYKNAHAHVLGELMGNGDSDFTRTVKHPVSPQKIMIAGIHDPHPYEANFISEHKI
QTCSPEQVRSGAQPVLDWIKNEKIEYLAIHIDLDVLDPHNFRSVLFAKPGRGQHDFGDVA
EGKLNIPDVVKLANQAASISKAVGLTIAEHLPWDALNLKNMLEELPLIGK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtattaataaaccgttgagactcattttcccgcaatggcaaggtggtgataat
cccccttactatttgggttcgcagcttttggcgtggttatcgcctgatcccaaaggtgcg
gttgaagaagttcctgttccaaaaccaacaggagaaccgctgcaagaagaaaatggcatt
gttgggcggtcaattttaatagatcagctatcaaaagcgcggcagttaatcgaaaagcac
acaccggattctctagttgtcttaggcggtgattgccttgtttctttagcacccttctca
tggcttcttgaaaaatataaagataagttagggattctttggatcgattcacatccagat
gttcaaacgcccaaggaatataaaaatgcgcatgcccatgtgcttggggaattgatgggt
aatggcgattctgattttaccagaacggttaaacacccagtatctccacaaaaaattatg
attgcgggcatacatgacccgcacccctatgaagcaaattttatttccgagcataaaatt
caaacttgctctccagaacaggtaaggtctggcgctcaacccgttttagactggatcaag
aatgaaaaaatcgaatatctggccatccatatagacttggatgttttggatccccataat
ttcagatctgttctttttgctaaaccgggtcgaggacagcatgatttcggggatgtcgca
gaaggcaaattaaacataccagatgtcgtaaaattagctaatcaagcggcctctatttcc
aaggcggtgggtttaactattgccgaacatctcccatgggatgcgcttaatttaaagaat
atgctcgaagagctgcctttaatcgggaaataa

DBGET integrated database retrieval system