KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0815Help
Entry
Za10_0815         CDS       T01110                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Za10_0815
  Amino acid metabolism
   00220 Arginine biosynthesis
    Za10_0815
   00330 Arginine and proline metabolism
    Za10_0815
Enzymes [BR:zmn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Za10_0815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
937240..938112
Genome map
AA seq 290 aa AA seqDB search
MSSINKPLRLIFPQWQGGDNPPYYLGSQLLAWLSPDPKGAVEEVPVPKPTGEPLQEENGI
VGRSILIDQLSKARQLIEKHTPDSLVVLGGDCLVSLAPFSWLLEKYKDKLGILWIDSHPD
VQTPKEYKNAHAHVLGELMGNGDSDFTRTVKHPVSPQKIMIAGIHDPHPYEANFISEHKI
QTCSPEQVRSGAQPVLDWIKNEKIEYLAIHIDLDVLDPHNFRSVLFAKPGRGQHDFGDVA
EGKLNIPDVVKLANQAASISKAVGLTIAEHLPWDALNLKNMLEELPLIGK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtattaataaaccgttgagactcattttcccgcaatggcaaggtggtgataat
cccccttactatttgggttcgcagcttttggcgtggttatcgcctgatcccaaaggtgcg
gttgaagaagttcctgttccaaaaccaacaggagaaccgctgcaagaagaaaatggcatt
gttgggcggtcaattttaatagatcagctatcaaaagcgcggcagttaatcgaaaagcac
acaccggattctctagttgtcttaggcggtgattgccttgtttctttagcacccttctca
tggcttcttgaaaaatataaagataagttagggattctttggatcgattcacatccagat
gttcaaacgcccaaggaatataaaaatgcgcatgcccatgtgcttggggaattgatgggt
aatggcgattctgattttaccagaacggttaaacacccagtatctccacaaaaaattatg
attgcgggcatacatgacccgcacccctatgaagcaaattttatttccgagcataaaatt
caaacttgctctccagaacaggtaaggtctggcgctcaacccgttttagactggatcaag
aatgaaaaaatcgaatatctggccatccatatagacttggatgttttggatccccataat
ttcagatctgttctttttgctaaaccgggtcgaggacagcatgatttcggggatgtcgca
gaaggcaaattaaacataccagatgtcgtaaaattagctaatcaagcggcctctatttcc
aaggcggtgggtttaactattgccgaacatctcccatgggatgcgcttaatttaaagaat
atgctcgaagagctgcctttaatcgggaaataa

DBGET integrated database retrieval system