KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0871Help
Entry
Za10_0871         CDS       T01110                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Za10_0871
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Za10_0871
   00052 Galactose metabolism
    Za10_0871
   00500 Starch and sucrose metabolism
    Za10_0871
   00520 Amino sugar and nucleotide sugar metabolism
    Za10_0871
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Za10_0871
   00524 Butirosin and neomycin biosynthesis
    Za10_0871
Enzymes [BR:zmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Za10_0871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(994156..995130)
Genome map
AA seq 324 aa AA seqDB search
MEIVAIDIGGTHARFSIAEVSNGRVLSLGEETTFKTAEHASLQLAWERFGEKLGRPLPRA
AAIAWAGPVHGEVLKLTNNPWVLRPATLNEKLDIDTHVLINDFGAVAHAVAHMDSSYLDH
ICGPDEALPSDGVITILGPGTGLGVAHLLRTEGRYFVIETEGGHIDFAPLDRLEDKILAR
LRERFRRVSIERIISGPGLGNIYEALAAIEGVPFSLLDDIKLWQMALEGKDNLAEAALDR
FCLSLGAIAGDLALAQGATSVVIGGGVGLRIASHLPESGFRQRFVSKGRFERVMSKIPVK
LITYPQPGLLGAAAAYANKYSEVE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgttgcgattgacatcggtggaacgcatgcgcgtttctctattgcggaagta
agcaatggtcgggttctttctcttggagaagaaacgacttttaaaacggcagaacatgct
agcttacagttagcttgggaacgtttcggtgaaaaactgggtcgtcctctgccacgtgcc
gcagctattgcatgggctggcccggttcatggtgaagttttaaaacttaccaataaccct
tgggtattaagaccagctactctgaatgaaaagctggacatcgatacgcatgttctgatc
aatgacttcggtgcggttgcccacgcggttgcgcatatggattcttcttatctggatcat
atttgtggtcctgatgaagcgcttcctagcgatggtgttatcactattcttggtccggga
acgggcttgggtgttgcccatctgttgcggactgaaggccgttatttcgtcatcgaaact
gaaggcggtcatatcgactttgctccgcttgacagacttgaagacaaaattctggcacgt
ttacgtgaacgtttccgccgcgtttctatcgaacgcattatttctggcccgggtcttggt
aatatctacgaagcactggctgccattgaaggcgttccgttcagcttgctggatgatatt
aaattatggcagatggctttggaaggtaaagacaaccttgctgaagccgctttggatcgc
ttctgcttgagccttggcgctatcgctggtgatcttgctttggcacagggtgcaaccagt
gttgttattggcggtggtgtcggtcttcgtatcgcttcccatttgccggaatctggcttc
cgtcagcgctttgtttcaaaaggacgctttgaacgcgtcatgtccaagattccggttaag
ttgattacttatccgcagcctggactgctgggtgcggcagctgcctatgccaacaaatat
tctgaagttgaataa

DBGET integrated database retrieval system