KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_0911Help
Entry
Za10_0911         CDS       T01110                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:zmn00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:zmn00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1050394..1050891)
Genome map
AA seq 165 aa AA seqDB search
MPSLSEIMLIFARAQNGVIGKDNTMPWHISADLKHFKALTLGHPMIMGRRTFESLPGLLP
KRPHIVLTHNHHWQAEGAEVVCDLEEAIKAARKYSSQIAVIGGANIFQQFWDKADRIELT
EIYRDYSGDTFVDLPDMNHFSLVGQEDFKAEGECPAFSFKSFLRK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgccttctttatctgaaataatgcttatttttgcccgcgctcaaaatggcgtaattggc
aaggataacaccatgccttggcatatttctgctgatttgaaacattttaaggccttaacg
cttggtcatccgatgattatggggcggcggacttttgagagtttgcccggcttgctgccg
aaaaggccacatattgttttgacccataatcatcattggcaggcggagggtgccgaagtc
gtttgtgatttggaagaggccataaaagcggctcggaaatatagtagccagatcgcggtg
attggtggagccaatatttttcaacaattttgggataaagcggatcggatcgaactgacc
gaaatttatcgcgattattccggtgatacctttgtcgatttgccggatatgaatcatttt
tctttggtaggacaagaggactttaaagcagaaggtgaatgccctgcttttagtttcaaa
tcatttctaaggaaataa

DBGET integrated database retrieval system