KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_1004Help
Entry
Za10_1004         CDS       T01110                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:zmn01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:zmn00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1169284..1170477
Genome map
AA seq 397 aa AA seqDB search
MVADLTSDISESQEQEIETNSANNNGAVFRPENCPRLVIKIGSSLLVDQRGQVRRDWLQT
VAYDIAKLHQAGQQIIVVSSGAIALGARRLNLPRGGRASLEDAQASASVGQILLSQCWAE
LLGACSLDSSQILLTLDDLEDRRRYLNVSATLDRLLSLGVVPVINENDSIATAEIRFGDN
DRLAARIGQASHASGVILFSDVDGLYTANPMKDPNAKRIDRVEHIDNSTEAMASSDSASG
MGSGGMASKVEAARIATYSGVNLAITTGKRPSPLTMFLDDGAGTLFTADESASAHKTWLA
GRLTAHGQVYIDQGAVEALHDGNSLLPAGVCSIEGKFNRGDVVDILDQEHNLIARGLIEY
DSEDSAQITGKRSQEIADILGYEARTALIHRNHMVML
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgatctaacttctgatatttcagaatcccaagagcaagaaatagaaactaac
tctgccaataataacggtgcggttttccgaccggaaaactgcccgcgactggttataaaa
attggttcttctttgctcgttgaccaacgcggtcaggttcgtcgtgattggctgcaaact
gtcgcctatgacattgccaaattgcatcaagctggacagcaaatcattgttgtttcctca
ggcgctatcgcactgggtgccagacgcttgaacttgccacgcggtggacgggcatccttg
gaagatgctcaagcctcggcttctgtcggacaaattttgcttagccaatgctgggcagaa
ttgctgggtgcatgcagcttggattcatcccaaattctactgacactggatgatctagaa
gatcgccgccgctatctgaacgtctcggctacgcttgatcgcctgctttctcttggtgtc
gtgccagtcatcaatgaaaatgactcgattgcgaccgcagaaattcgttttggggataat
gaccgtctcgctgctcgcatcgggcaggccagccatgcctctggcgttatcctcttttcg
gatgtggatggcctttacacggccaaccccatgaaagatcccaacgccaaacggattgat
cgggtcgaacatatcgacaatagcacagaagccatggctagcagtgattccgcttccggc
atgggttctggcggcatggcttccaaggtagaagcggcgcgcatcgccacctattctggc
gttaatctcgcgattacaacgggtaaacgcccttccccgctgacgatgtttttggatgat
ggtgctggcacgctattcacagccgatgaaagcgcttcagctcataaaacatggctggcc
ggacgattaaccgctcatggtcaggtttatatcgatcaaggcgcagtcgaggcactccat
gatggaaacagcctgctccctgcgggcgtctgctccatagaaggcaaattcaaccgcggt
gacgtggtcgatatcctcgatcaagaacacaaccttattgcgcggggtctgatcgaatat
gacagcgaagattctgcccaaatcacaggcaagcgatcgcaggaaattgctgatattcta
ggatatgaggccagaacagccctgatccatcgcaatcatatggttatgctatga

DBGET integrated database retrieval system