KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_1241Help
Entry
Za10_1241         CDS       T01110                                 

Definition
(GenBank) Uroporphyrinogen-III synthase-like protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
zmn00860  Porphyrin and chlorophyll metabolism
zmn01100  Metabolic pathways
zmn01110  Biosynthesis of secondary metabolites
zmn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Za10_1241
Enzymes [BR:zmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Za10_1241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACV75784
JGI: Za10_1241
Position
1449712..1450440
Genome map
AA seq 242 aa AA seqDB search
MLREWQLNNRVQDKLLILRPEPGATATAKRAEKVGWQVIKTPLATAISIPWSINESLSFD
AVMVTSAQAIYHGGSELDKLKDYPLYVVGKATEAAARQAGFQHIVTAEGNGASVLCCLER
DKRMRILRLCGEIYKDYDYKNFSLKENTQFFIKILYRMQNIASLPIEACQALVENAIVLL
HSSRFAEQFRLLLAKTDINPDRVQIAVISPAVAEQIGKEWRAMAIAEYPDDTSLLKAAAS
LK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgctgagagaatggcaattaaataatcgtgttcaagataaattattgattttacgcccc
gagccgggggcaaccgctacagccaagcgtgcagaaaaagtaggttggcaagtaataaaa
acgcctcttgcaacggctatatcgataccttggtcaataaatgaatctctatcttttgat
gcggttatggtaacgagtgcccaagctatttatcacggaggaagtgaactggataaatta
aaagactatcctctttacgtggttggcaaggctactgaggcggcggcacgtcaggcaggg
tttcagcatattgtaacggccgaaggtaatggcgcatctgtactttgttgtcttgaacgg
gacaaaagaatgcggatattaaggctctgcggcgagatttacaaagattatgactataaa
aatttttctctgaaagaaaacactcaattctttataaaaattctttatagaatgcaaaat
attgccagtttaccgatagaagcctgtcaggcattagtagaaaatgccatagtcctatta
cactcttctcgttttgcagagcaatttcgtcttttgcttgcgaaaacggatatcaatcca
gacagagttcagattgctgttattagcccagcagtagcagaacaaattggaaaagagtgg
cgagcaatggcaatagctgaatatcctgatgacacatctttgttaaaggcggcagctagc
ttgaaatga

DBGET integrated database retrieval system