KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_1251Help
Entry
Za10_1251         CDS       T01110                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Za10_1251
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Za10_1251
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Za10_1251
Enzymes [BR:zmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Za10_1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1459771..1461168
Genome map
AA seq 465 aa AA seqDB search
MRYISTRGAAAAQDFKGVTLTGLASDGGLYVPENWPAFSREDIAALAGLSYVDTAVAVMR
PFVSGVLDDQALKNLCEAAYGQFNHAAVTPLVQLDERHFLLELFHGPTLAFKDVALQLLG
HLFEKFLSEEKGQDLTIVGATSGDTGSAAISAVAGRAGVQIVMLHPNGRVSEVQRRQMTT
VLDKNVHNVAIDGSFDDAQAIVKAMFNDSDFRKRHRLGAVNSINWARLMAQIVYYFYAAV
RLGAPDRKVAFSVPTGNFGDVFAGYAAKKMGLPVEKLIVATNINDILYRALSAGDYSVGN
VTPTDAPSMDIQISSNFERLLFDLHGRDAASLAATMAQFEQSRAIQISDAMRQQAATIFS
SKRIDPDEMAATMRWASDKAGQVIDPHTAIGLAAARETDLPKDVPVVTLATAHPAKFPDA
VSRITGKNAPLPHRLADLYSREERYVELPASRQTIQAYIDAGFQL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcagtacaaggggcgcggctgccgcgcaggattttaagggggttacctta
accgggcttgcttcggatggtggtctctatgtgccagaaaattggccagccttcagccgc
gaggatatcgctgcattagcaggattgtcctatgtcgatacggctgttgcggttatgcgg
ccatttgtcagcggtgtgctcgacgatcaggcattaaaaaatctgtgcgaagccgcttat
ggtcagttcaaccatgcagctgttacgccgttggttcagttagatgaacggcatttcttg
ctggaattatttcatggcccgaccttggctttcaaggatgttgctttacaacttctcggt
catttatttgaaaaattcctttccgaagaaaaaggacaggatctgacaatcgtcggagca
acctccggtgatactggatcagcggctatatctgctgttgctggacgagctggcgtgcaa
attgtgatgttgcatccaaacggtcgggtttccgaagttcaacgtcgccaaatgacgacg
gttctcgacaaaaatgtccataatgtcgcgattgacggtagctttgatgatgcacaggct
attgttaaagccatgttcaacgatagcgactttagaaaacgtcatcgtctaggcgctgtt
aattcgattaactgggcccgcttgatggctcagatcgtttattatttctatgcggctgtt
cgtcttggtgcacctgatcggaaagtcgctttttctgttcctaccggtaactttggtgat
gtttttgcgggttatgctgccaaaaaaatggggcttcctgtcgaaaaattgatcgttgcg
actaacatcaatgatatcctttatcgggcattatcagccggtgattattctgtcggtaat
gtaaccccgactgatgcgccgtcgatggatatccaaatcagttccaattttgaacgcttg
ctttttgaccttcatggtcgggatgcggcttctttggcggcaacaatggcgcaatttgaa
cagagtcgtgctattcagatttctgatgcaatgcgccagcaagctgcaacgatattcagc
agcaaacgcattgatcccgatgaaatggctgcaaccatgcgttgggcttccgataaagca
ggacaggttattgatcctcatacggctattggtttggcggccgcccgtgaaacagatctt
ccaaaggatgttccagtcgttaccttggcaactgcccatccggcaaaattccctgatgct
gtttcccgtattacgggtaaaaatgctcctctgccgcatcgtttggctgatctttacagc
cgtgaagaacgctatgttgaactgcctgcgtcacgtcagacaattcaggcttatattgat
gccggattccagctttga

DBGET integrated database retrieval system