KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_1459Help
Entry
Za10_1459         CDS       T01110                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Za10_1459
   00052 Galactose metabolism
    Za10_1459
   00500 Starch and sucrose metabolism
    Za10_1459
   00520 Amino sugar and nucleotide sugar metabolism
    Za10_1459
Enzymes [BR:zmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Za10_1459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1690356..1691222
Genome map
AA seq 288 aa AA seqDB search
MKPVRKAIFPVAGQGTRFLPATKAMPKEMLPVVDRPLIQYAVDEARAAGIEELIFVTGRG
KQAIEDYFDIAYELEVSLVAKGKTGMLDLLEGTRVAPGRACFIRQQEPLGLGHAVWCARD
LIGDEPFAVLLPDELLWNPEKPSLVQLVETYNQKGGNVVTVMEVPEEHTHRYGIVDPGKT
DGEVTEVKGLVEKPEKAPSRLAMTGRYILQPDIMPLLAQDNRGVGGEIQLTDSMAQLIGK
QPFHACRFGGIRHDCGDKAGFIQANVALALERPDIGPAVRDYLHRQNF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgtccgtaaagcaattttccctgttgccggccaaggcacccgctttttgcca
gcaaccaaggccatgcccaaggaaatgctgccggtcgttgatcgccctttgattcaatat
gctgtcgatgaagcacgggcagccggcattgaagaactgatctttgttaccggacgtggc
aagcaggctatcgaagattatttcgatatcgcctacgaattggaagtttctttggttgcc
aagggcaaaaccggaatgctggatttgctagaaggtacgcgggtggctccgggtcgtgcc
tgttttattcggcaacaggaaccgttaggtttgggacatgctgtctggtgcgcccgtgat
ttgatcggcgatgaaccttttgctgttcttttgcccgatgaattactttggaatcctgaa
aaacccagtctggtgcaattggttgagacctataaccagaaagggggtaacgtcgtaacc
gtgatggaagtccccgaagagcatacccatcgttatggtatcgttgaccccggtaaaact
gacggcgaggttaccgaggtgaaaggtctggttgaaaaaccggaaaaagccccttcgcgg
ttagccatgacgggacgttatattctccaaccggatattatgcctttattggctcaggat
aatcgcggtgtcggtggtgaaattcagttgacggattcgatggcacagctgatcgggaag
caaccttttcacgcttgtcgctttggcggtattcgccatgactgcggtgataaggccgga
tttattcaggcaaatgttgcgttagccttggaaagacctgatataggccctgcggttaga
gactatctacatcgccaaaatttttaa

DBGET integrated database retrieval system