KEGG   Zymomonas mobilis subsp. mobilis NCIMB 11163: Za10_1570Help
Entry
Za10_1570         CDS       T01110                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
zmn  Zymomonas mobilis subsp. mobilis NCIMB 11163
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Za10_1570
Enzymes [BR:zmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Za10_1570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1807193..1807744
Genome map
AA seq 183 aa AA seqDB search
MLYAIALGSNRWHGRYGRPSAVIEAAIAALEKEKIAIHSRAPIFETSAVGPGGRRYANSA
IIIKTDLQPLALLALCKKIEQAFGRRKGQRWGARVLDLDIVLWEKGRWPRKIQPRLRYKP
ALAAGQPPALWPKLHIPHLEISRRDFVLKPLLSIAGNWPVFQKNGFFTVKQLYFRYKYLT
SKQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgctttacgctatcgcactaggctctaatcgttggcatggtcggtatggtcggccatct
gcggtcatcgaggcggcgattgctgcattggaaaaagaaaagattgcgatccattctcgc
gctccgatttttgaaacctcagctgtcgggcccggtggacggcgttatgccaattccgca
attattattaaaacagatttgcagccgcttgcattgctggcgctttgtaaaaaaatagaa
caggctttcggcagacgaaaagggcaaagatggggggcgagggtgctcgatcttgatatt
gtcttatgggaaaaaggccgctggccacgaaaaatacaaccccgccttcgctacaagcct
gccttggctgcaggacaaccaccggctttatggccaaaacttcatattccccatcttgag
atcagtcgtcgcgattttgtgctgaaacctttgctttcgatcgccggaaattggcctgtt
tttcaaaaaaatggattttttacggtaaaacagctatattttcgctataagtacttgacc
tccaagcaataa

DBGET integrated database retrieval system