KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0081Help
Entry
ZMO0081           CDS       T00221                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ZMO0081
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    ZMO0081
Enzymes [BR:zmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     ZMO0081
Two-component system [BR:zmo02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   ZMO0081
Bacterial motility proteins [BR:zmo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ZMO0081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(70349..71407)
Genome map
AA seq 352 aa AA seqDB search
MTVKVLIVDDSPTMRAILSMMISSDPEIEVVGKADCPSTARQMIKELNPDVMTLDIEMPG
MDGLDFLEKVMRLRPMPVIMVSALTAAGAEATLKAMELGAFDCFAKPALGFASDKSQSQT
LISMIKAAAKNGGHRPLSFRNRSASAQNAAPAPSSVASGYRPKPGSIIAIGASTGGVETL
LALLKDFPANCPPTLIVQHMPPLFTASFANRLDRMCPPKVSEAKTGDPLTPGHIYIAPGG
ERHLEFQNAAHGPRCLLVSDEPMSGHRPSVDRLFLSVAKNCGRRAIGIILTGMGQDGAMG
LKAMRDTGSFTIGQDEESCVVYGMPAAAYRMGAVESQLPLSRIAAKALEACA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtcaaagtacttatcgtcgatgactcgccaacaatgcgtgccatcctatccatg
atgatttcgtcagatccggaaatcgaagtcgtcggcaaagcagactgtccctctacagcc
cgccagatgattaaagaactcaatcccgatgtcatgacgctggatattgaaatgccgggc
atggacggattggattttcttgaaaaggtgatgcggctgcgtccgatgcctgtcatcatg
gtctcggccttaaccgcagcaggtgccgaagccaccttaaaggccatggaattaggtgcc
tttgactgctttgccaaacccgcgctcggctttgcctctgataaaagtcaaagccagacg
ttaatcagcatgatcaaggccgctgctaaaaacggaggccatcgcccactttctttccgc
aaccgttcggcctctgcccaaaatgcagcgcccgctccatcaagcgtggcttccggctat
cgtccgaaaccgggcagcatcattgctatcggtgcttcaactggcggtgttgaaacgctg
ttagctttgctgaaagattttccggccaattgcccgccgactttgatcgtgcagcatatg
cctcctttattcacagcaagctttgcgaaccgtcttgatcgaatgtgtcctcccaaggtg
tccgaagctaaaaccggtgatcctttgacaccgggacatatttacatcgctccgggtggg
gaacgccatcttgaattccaaaatgctgcccatggaccgcgctgtcttttggtctccgat
gagccgatgtcgggtcatcgcccttcagtcgatagattattcttatcggttgccaaaaat
tgcggtcgtcgagcaatcggtattattctgaccggtatgggacaagatggtgcgatggga
ctgaaagccatgcgcgatacaggttcctttaccattggacaggatgaagaaagctgcgtt
gtttacggaatgcccgctgcggcttatcgtatgggcgccgttgaaagccaactgccctta
tcccgtattgccgccaaagcgttggaggcctgcgcctaa

DBGET integrated database retrieval system