KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0155Help
Entry
ZMO0155           CDS       T00221                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ZMO0155
Enzymes [BR:zmo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ZMO0155
DNA repair and recombination proteins [BR:zmo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ZMO0155
    RecFOR pathway proteins
     ZMO0155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
140421..141062
Genome map
AA seq 213 aa AA seqDB search
MIARLVGFLVEKNSDSAVIDVNGVGYLVQLSGRALDYFSEIEGEITVHIETQIREDSITL
FGFASYLERDWFRLLTSVQGVGGKAALAILTALTCDAISVAISSGDKTMICRANGIGPKI
AQRIINELKEKPAAIALFSSAKGDHLAVEDISQPAASAHHAGNFMADAVSALLNLGFKPA
EAQRVVQLASEELGDQATLDSLVRLALRLSSKH
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgcgattggttggttttctggtagaaaaaaattctgattctgcggtcattgac
gttaatggcgtcggctatctcgtccaattatcaggacgcgctttagattatttctccgaa
attgaaggtgaaattactgtccatatcgaaacccaaattcgggaagattcgattaccctt
tttggttttgcttcttatctggaacgggattggttccggcttttaacgtcggtgcaaggc
gtggggggcaaagccgctctggctattttaacggcgttgacctgcgatgcgatttctgta
gcgatttccagtggcgacaagaccatgatttgtcgcgccaatgggataggccccaaaatt
gcccagcgtattatcaatgaattgaaagagaaaccggcggctattgcgttgttttcttct
gccaaaggcgaccatctggcggttgaagatatttcccagccagcagcctctgcccatcat
gcgggtaatttcatggcagatgcggtgtctgcgcttttgaatttagggtttaaaccggct
gaagcgcaacgcgttgttcaattggcttcggaagaattaggcgatcaagcaacattagat
agtcttgtacgtctggctttacggttatcttccaagcattaa

DBGET integrated database retrieval system