KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0155Help
Entry
ZMO0155           CDS       T00221                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ZMO0155
Enzymes [BR:zmo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ZMO0155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
140421..141062
Genome map
AA seq 213 aa AA seqDB search
MIARLVGFLVEKNSDSAVIDVNGVGYLVQLSGRALDYFSEIEGEITVHIETQIREDSITL
FGFASYLERDWFRLLTSVQGVGGKAALAILTALTCDAISVAISSGDKTMICRANGIGPKI
AQRIINELKEKPAAIALFSSAKGDHLAVEDISQPAASAHHAGNFMADAVSALLNLGFKPA
EAQRVVQLASEELGDQATLDSLVRLALRLSSKH
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgcgattggttggttttctggtagaaaaaaattctgattctgcggtcattgac
gttaatggcgtcggctatctcgtccaattatcaggacgcgctttagattatttctccgaa
attgaaggtgaaattactgtccatatcgaaacccaaattcgggaagattcgattaccctt
tttggttttgcttcttatctggaacgggattggttccggcttttaacgtcggtgcaaggc
gtggggggcaaagccgctctggctattttaacggcgttgacctgcgatgcgatttctgta
gcgatttccagtggcgacaagaccatgatttgtcgcgccaatgggataggccccaaaatt
gcccagcgtattatcaatgaattgaaagagaaaccggcggctattgcgttgttttcttct
gccaaaggcgaccatctggcggttgaagatatttcccagccagcagcctctgcccatcat
gcgggtaatttcatggcagatgcggtgtctgcgcttttgaatttagggtttaaaccggct
gaagcgcaacgcgttgttcaattggcttcggaagaattaggcgatcaagcaacattagat
agtcttgtacgtctggctttacggttatcttccaagcattaa

DBGET integrated database retrieval system