KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0155Help
Entry
ZMO0155           CDS       T00221                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:zmo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
140421..141062
Genome map
AA seq 213 aa AA seqDB search
MIARLVGFLVEKNSDSAVIDVNGVGYLVQLSGRALDYFSEIEGEITVHIETQIREDSITL
FGFASYLERDWFRLLTSVQGVGGKAALAILTALTCDAISVAISSGDKTMICRANGIGPKI
AQRIINELKEKPAAIALFSSAKGDHLAVEDISQPAASAHHAGNFMADAVSALLNLGFKPA
EAQRVVQLASEELGDQATLDSLVRLALRLSSKH
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgcgattggttggttttctggtagaaaaaaattctgattctgcggtcattgac
gttaatggcgtcggctatctcgtccaattatcaggacgcgctttagattatttctccgaa
attgaaggtgaaattactgtccatatcgaaacccaaattcgggaagattcgattaccctt
tttggttttgcttcttatctggaacgggattggttccggcttttaacgtcggtgcaaggc
gtggggggcaaagccgctctggctattttaacggcgttgacctgcgatgcgatttctgta
gcgatttccagtggcgacaagaccatgatttgtcgcgccaatgggataggccccaaaatt
gcccagcgtattatcaatgaattgaaagagaaaccggcggctattgcgttgttttcttct
gccaaaggcgaccatctggcggttgaagatatttcccagccagcagcctctgcccatcat
gcgggtaatttcatggcagatgcggtgtctgcgcttttgaatttagggtttaaaccggct
gaagcgcaacgcgttgttcaattggcttcggaagaattaggcgatcaagcaacattagat
agtcttgtacgtctggctttacggttatcttccaagcattaa

DBGET integrated database retrieval system