KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0206Help
Entry
ZMO0206           CDS       T00221                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZMO0206
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ZMO0206
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    ZMO0206
Enzymes [BR:zmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ZMO0206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(198769..199962)
Genome map
AA seq 397 aa AA seqDB search
MVADLTSDISESQEQETETNSANNNGAVFRPENCPRLVIKIGSSLLVDQRGQVRRDWLQT
VAYDIAKLHQAGQQIIVVSSGAIALGARRLNLPRGGRASLEDAQASASVGQILLSQCWAE
LLGACSLDSSQILLTLDDLEDRRRYLNVSATLDRLLSLGVVPVINENDSIATAEIRFGDN
DRLAARIGQASHASGVILFSDVDGLYTANPMKDPNAKRIDRVEHIDNSTEAMASSDSASG
MGSGGMASKVEAARIATYSGVNLAITTGKRPSPLTMFLDDGAGTLFTADESASAHKTWLA
GRLTAHGQVYIDQGAVEALHDGNSLLPAGVCSIEGKFNRGDVVDILDQEHNLIARGLIEY
DSEDSAQITGKRSQEIADILGYEARTALIHRNHMVML
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgatctaacttctgatatttcagaatcccaagagcaagaaacagaaactaac
tctgccaataacaacggtgcggttttccgaccggaaaactgcccgcgactggttataaaa
attggttcttctttgctcgttgaccaacgcggtcaagttcgtcgcgattggctgcaaact
gtcgcctatgacattgccaaattgcatcaagctggacagcaaatcattgttgtttcctca
ggcgctatcgcactgggtgccagacgcttgaacttgccacgcggtggacgggcatccttg
gaagatgctcaagcctcggcttctgtcggacaaattttgcttagccaatgctgggcagaa
ttgctgggtgcatgcagcttggattcatcccaaattctactgacactggatgatctggaa
gatcgccgccgctatctgaacgtctcggctacgcttgatcgcctgctttctcttggtgtc
gtgccagtcatcaatgaaaatgactcgattgcgaccgcagaaattcgttttggagataat
gaccgtctcgctgctcgcatcgggcaggccagccatgcctctggcgttatcctcttttcg
gatgtggatggcctttacacggccaaccccatgaaagatcccaacgccaaacggattgat
cgggtcgaacatatcgacaatagcacagaagctatggctagcagtgattctgcttccggc
atgggttctggcggcatggcttccaaggtagaagcggcgcgtatcgccacctattccggc
gttaatctcgcgattacaacgggtaaacgcccttccccgctgacgatgtttttggatgat
ggtgctggcacgctattcacagccgatgaaagcgcttcagctcataaaacatggctggcc
ggacgattaaccgctcatggtcaggtttatatcgatcaaggcgcagtcgaggcactccat
gatggaaacagcctgctccctgcgggcgtctgctccatagaaggcaagttcaaccgcggt
gacgtggtcgatatcctcgatcaagaacacaaccttattgcgcggggtctgatcgaatat
gacagcgaagattctgcccaaatcacaggcaagcggtcgcaggaaattgctgatattcta
ggatatgaggccagaacagccctgatccatcgcaatcatatggttatgctatga

DBGET integrated database retrieval system