KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0321Help
Entry
ZMO0321           CDS       T00221                                 

Definition
dihydrofolate reductase region
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ZMO0321
   00670 One carbon pool by folate
    ZMO0321
Enzymes [BR:zmo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ZMO0321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
317965..318390
Genome map
AA seq 141 aa AA seqDB search
MPWHISADLKHFKALTLGHPMIMGRRTFESLPGLLPKRPHIVLTHNHHWQAEGAEAVCDL
EEAIKAARKYSSQIAVIGGANIFQQFWDKADRIELTEIYRDYSGDTFVDLPDMNHFSLVG
QEDFKAEGECPAFSFKSFLRK
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccttggcatatttctgctgatttgaaacattttaaggccttaacgcttggtcatccg
atgattatggggcggcggacttttgagagtttgcccggcttgctgccgaaaaggccacat
attgttttgacccataatcatcattggcaggcggagggtgccgaagctgtttgtgatttg
gaagaggccataaaagcggctcggaaatatagtagccagatcgcggtgattggtggagcc
aatatttttcaacaattttgggataaagcggatcggatcgaactgaccgaaatttatcgc
gattattccggtgatacctttgtcgatttgccggatatgaatcatttttctttggtaggg
caagaggattttaaagcagaaggtgaatgccctgcttttagtttcaaatcatttctaagg
aaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system