KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0321Help
Entry
ZMO0321           CDS       T00221                                 

Definition
dihydrofolate reductase region
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:zmo00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:zmo00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
317965..318390
Genome map
AA seq 141 aa AA seqDB search
MPWHISADLKHFKALTLGHPMIMGRRTFESLPGLLPKRPHIVLTHNHHWQAEGAEAVCDL
EEAIKAARKYSSQIAVIGGANIFQQFWDKADRIELTEIYRDYSGDTFVDLPDMNHFSLVG
QEDFKAEGECPAFSFKSFLRK
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccttggcatatttctgctgatttgaaacattttaaggccttaacgcttggtcatccg
atgattatggggcggcggacttttgagagtttgcccggcttgctgccgaaaaggccacat
attgttttgacccataatcatcattggcaggcggagggtgccgaagctgtttgtgatttg
gaagaggccataaaagcggctcggaaatatagtagccagatcgcggtgattggtggagcc
aatatttttcaacaattttgggataaagcggatcggatcgaactgaccgaaatttatcgc
gattattccggtgatacctttgtcgatttgccggatatgaatcatttttctttggtaggg
caagaggattttaaagcagaaggtgaatgccctgcttttagtttcaaatcatttctaagg
aaataa

DBGET integrated database retrieval system