KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0369Help
Entry
ZMO0369           CDS       T00221                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZMO0369
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO0369
   00052 Galactose metabolism
    ZMO0369
   00500 Starch and sucrose metabolism
    ZMO0369
   00520 Amino sugar and nucleotide sugar metabolism
    ZMO0369
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ZMO0369
   00524 Butirosin and neomycin biosynthesis
    ZMO0369
Enzymes [BR:zmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ZMO0369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
373654..374628
Genome map
AA seq 324 aa AA seqDB search
MEIVAIDIGGTHARFSIAEVSNGRVLSLGEETTFKTAEHASLQLAWERFGEKLGRPLPRA
AAIAWAGPVHGEVLKLTNNPWVLRPATLNEKLDIDTHVLINDFGAVAHAVAHMDSSYLDH
ICGPDEALPSDGVITILGPGTGLGVAHLLRTEGRYFVIETEGGHIDFAPLDRLEDKILAR
LRERFRRVSIERIISGPGLGNIYEALAAIEGVPFSLLDDIKLWQMALEGKDNLAEAALDR
FCLSLGAIAGDLALAQGATSVVIGGGVGLRIASHLPESGFRQRFVSKGRFERVMSKIPVK
LITYPQPGLLGAAAAYANKYSEVE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgttgcgattgacatcggtggaacgcatgcgcgtttctctattgcggaagta
agcaatggtcgggttctttctcttggagaagaaacgacttttaaaacggcagaacatgct
agcttacagttagcttgggaacgtttcggtgaaaaactgggtcgtcctctgccacgtgcc
gcagctattgcatgggctggcccggttcatggtgaagttttaaaacttaccaataaccct
tgggtattaagaccagctactctgaatgaaaagctggacatcgatacgcatgttctgatc
aatgacttcggtgcggttgcccacgcggttgcgcatatggattcttcttatctggatcat
atttgtggtcctgatgaagcgcttcctagcgatggtgttatcactattcttggtccggga
acgggcttgggtgttgcccatctgttgcggactgaaggccgttatttcgtcatcgaaact
gaaggcggtcatatcgactttgctccgcttgacagacttgaagacaaaattctggcacgt
ttacgtgaacgtttccgccgcgtttctatcgaacgcattatttctggcccgggtcttggt
aatatctacgaagcactggctgccattgaaggcgttccgttcagcttgctggatgatatt
aaattatggcagatggctttggaaggtaaagacaaccttgctgaagccgctttggatcgc
ttctgcttgagccttggcgctatcgctggtgatcttgctttggcacagggtgcaaccagt
gttgttattggcggtggtgtcggtcttcgtatcgcttcccatttgccggaatctggcttc
cgtcagcgctttgtttcaaaaggacgctttgaacgcgtcatgtccaagattccggttaag
ttgattacttatccgcagcctggactgctgggtgcggcagctgcctatgccaacaaatat
tctgaagttgaataa

DBGET integrated database retrieval system