KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0420Help
Entry
ZMO0420           CDS       T00221                                 

Definition
(GenBank) Arogenate dehydrogenase
  KO
K00220  cyclohexadieny/prephenate dehydrogenase [EC:1.3.1.43 1.3.1.12]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zmo00401  Novobiocin biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01230  Biosynthesis of amino acids
Module
zmo_M00040  Tyrosine biosynthesis, prephanate => pretyrosine => tyrosine
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZMO0420
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    ZMO0420
Enzymes [BR:zmo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     ZMO0420
    1.3.1.43  arogenate dehydrogenase
     ZMO0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH NAD_binding_2 F420_oxidored 2-Hacid_dh_C IlvN NAD_Gly3P_dh_N Rossmann-like GFO_IDH_MocA OCD_Mu_crystall TrkA_N AlaDh_PNT_C AdoHcyase_NAD 3HCDH_N NAD_binding_3 NAD_binding_7 ApbA
Motif
Other DBs
NCBI-ProteinID: AAV89044
UniProt: Q04983
Position
complement(420567..421448)
Genome map
AA seq 293 aa AA seqDB search
MTVFKHIAIIGLGLIGSSAARATKAYCPDVTVSLYDKSEFVRDRARALNLGDNVTDDIQD
AVREADLVLLCVPVRAMGIVAAAMAPALKKDVIICDTGSVKVSVIKTLQDNLPNHIIVPS
HPLAGTENNGPDAGFAELFQDHPVILTPDAHTPAQAIAYIADYWEEIGGRINLMSAEHHD
HVLALTSHLPHVIAYQLIGMVSGYEKKSRTPIMRYSAGSFRDATRVAASEPRLWQDIMLE
NAPALLPVLDHFIADLKKLRTAIASQDGDYLLEHFKESQKARLALKTDHDIRP
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtctttaagcatattgccattatcggattaggactgatcggttcctctgcggca
cgggcaacaaaggcctattgtcctgatgtaacggtcagtctctatgacaaaagcgaattt
gtccgcgacagagctagagcgctcaatctcggcgacaatgtcaccgatgatattcaagat
gcggttcgtgaggctgatctggtgctgctatgcgtgccagtcagggcaatgggtatcgtc
gcggcagcgatggcaccggcactgaaaaaagacgttattatctgcgatacaggttcggta
aaagtcagcgttataaaaacgctgcaagacaatttacccaatcacattattgttcccagc
catcctttggctgggactgaaaataacggacccgatgccggttttgctgaattattccaa
gatcatcctgttattttgacccccgatgcccatacaccagcacaggctatcgcctatatc
gccgattattgggaagaaattggtgggcgtatcaatctgatgtcggcggaacatcacgat
cacgttttggcgcttaccagccatttgcctcatgtcattgcataccaacttatcgggatg
gtatcgggttatgagaaaaaaagccggacacccattatgcgttattcggcaggcagcttt
cgggatgcgacgcgggtagcggcttcggaaccgcgtctctggcaagatattatgctggaa
aatgcgcccgcccttttaccagtgctggatcattttatcgcagatctcaaaaaattgcgg
acagccattgcttcgcaagatggggattatcttcttgagcatttcaaagaatcgcagaaa
gcgcgtttagccttaaaaacagaccacgatattcgcccttaa

DBGET integrated database retrieval system