KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0420Help
Entry
ZMO0420           CDS       T00221                                 

Definition
(GenBank) Arogenate dehydrogenase
  KO
K00220  
cyclohexadieny/prephenate dehydrogenase [EC:1.3.1.43 1.3.1.12]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tyrosine biosynthesis, prephanate => pretyrosine => tyrosine
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZMO0420
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    ZMO0420
Enzymes [BR:zmo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     ZMO0420
    1.3.1.43  arogenate dehydrogenase
     ZMO0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(420567..421448)
Genome map
AA seq 293 aa AA seqDB search
MTVFKHIAIIGLGLIGSSAARATKAYCPDVTVSLYDKSEFVRDRARALNLGDNVTDDIQD
AVREADLVLLCVPVRAMGIVAAAMAPALKKDVIICDTGSVKVSVIKTLQDNLPNHIIVPS
HPLAGTENNGPDAGFAELFQDHPVILTPDAHTPAQAIAYIADYWEEIGGRINLMSAEHHD
HVLALTSHLPHVIAYQLIGMVSGYEKKSRTPIMRYSAGSFRDATRVAASEPRLWQDIMLE
NAPALLPVLDHFIADLKKLRTAIASQDGDYLLEHFKESQKARLALKTDHDIRP
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtctttaagcatattgccattatcggattaggactgatcggttcctctgcggca
cgggcaacaaaggcctattgtcctgatgtaacggtcagtctctatgacaaaagcgaattt
gtccgcgacagagctagagcgctcaatctcggcgacaatgtcaccgatgatattcaagat
gcggttcgtgaggctgatctggtgctgctatgcgtgccagtcagggcaatgggtatcgtc
gcggcagcgatggcaccggcactgaaaaaagacgttattatctgcgatacaggttcggta
aaagtcagcgttataaaaacgctgcaagacaatttacccaatcacattattgttcccagc
catcctttggctgggactgaaaataacggacccgatgccggttttgctgaattattccaa
gatcatcctgttattttgacccccgatgcccatacaccagcacaggctatcgcctatatc
gccgattattgggaagaaattggtgggcgtatcaatctgatgtcggcggaacatcacgat
cacgttttggcgcttaccagccatttgcctcatgtcattgcataccaacttatcgggatg
gtatcgggttatgagaaaaaaagccggacacccattatgcgttattcggcaggcagcttt
cgggatgcgacgcgggtagcggcttcggaaccgcgtctctggcaagatattatgctggaa
aatgcgcccgcccttttaccagtgctggatcattttatcgcagatctcaaaaaattgcgg
acagccattgcttcgcaagatggggattatcttcttgagcatttcaaagaatcgcagaaa
gcgcgtttagccttaaaaacagaccacgatattcgcccttaa

DBGET integrated database retrieval system