KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0433Help
Entry
ZMO0433           CDS       T00221                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00230  Purine metabolism
zmo01100  Metabolic pathways
Module
zmo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ZMO0433
Enzymes [BR:zmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ZMO0433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 MMR_HSR1 AAA_22 AAA_18 AAA_16 ABC_tran AAA_29 CPT RsgA_GTPase AAA_23
Motif
Other DBs
NCBI-ProteinID: AAV89057
UniProt: Q5NQE8
Position
complement(431859..432509)
Genome map
AA seq 216 aa AA seqDB search
MPSANFRLARRGLLFVISSPSGAGKSTIARRILAEDDEIHLSVSVTTRPKRPGEVDGVDY
HFVDVPTFKKMVAENQLLEWAHVFDNRYGTPRAPVEEMLHKGQDVLFDIDWQGAQQLWQQ
ASGDTIRVYILPPSFEELERRLRGRGTDSEEVIQKRMARAASEISHWDGYDYVLINDDMD
ECVKQVKNILTVERIKRRRQIGLIGFTRKLLAPPED
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgccttcagctaattttcgactagcccgccgtggacttctttttgttatatcctcaccc
tcaggtgcaggtaagtccactatcgcccgtagaatactggccgaagatgatgaaattcat
ctgtcagtttctgttacaacgcgtcccaaacgaccaggggaagttgacggagtagattat
catttcgtcgatgtcccgacttttaaaaagatggtcgccgagaaccagcttttggaatgg
gcgcatgtttttgataatcgctatggtacgccccgcgcccctgttgaagaaatgcttcac
aaaggccaagatgtcctctttgatatcgactggcaaggcgcgcaacagctctggcaacag
gccagcggcgatacgatacgcgtttatattcttcccccttcttttgaagaactggaacgc
cggttaagaggtcggggaaccgattccgaagaagttatccaaaaaagaatggcacgcgct
gcaagcgagataagccattgggatggctatgattatgttttgatcaatgatgacatggat
gaatgtgtcaaacaggtgaaaaacattttgacggtcgaaagaattaaaagacgccgccaa
atcggccttattggctttacccgcaaattattggcaccacccgaagattaa

DBGET integrated database retrieval system