KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0465Help
Entry
ZMO0465           CDS       T00221                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZMO0465
   01230 Biosynthesis of amino acids
    ZMO0465
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO0465
   00051 Fructose and mannose metabolism
    ZMO0465
   00562 Inositol phosphate metabolism
    ZMO0465
Enzymes [BR:zmo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ZMO0465
Exosome [BR:zmo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ZMO0465
  Exosomal proteins of bladder cancer cells
   ZMO0465
  Exosomal proteins of melanoma cells
   ZMO0465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(457462..458211)
Genome map
AA seq 249 aa AA seqDB search
MTIRKLIAGNWKMNGSLGMLHELDGIAKATFNHPELDVVICPSFTLIAPAIVRQPDMTFG
AQDCHYDESGSHTGCVSAPMLREVGASYVIVGHSERRIEQNETNEEIRAKTTTAIANGLV
TIVCIGESRAAHASGQALPIIGAQLDGCIPPDATSDNLVVAYEPIWAIGTGNTPPPESIA
EMHASIRDRLCLLLGSEGKKVRILYGGSVTGKNAEELMAIPDVNGTLVGGASLTAEQFVP
IIEAGGRLA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacaatacgcaagctcatcgccggcaattggaaaatgaacggttctttaggcatgttg
cacgaactggacgggatcgccaaggcaacctttaaccatccagaacttgatgtcgtgatt
tgtccatccttcacgctgatagcgcccgctattgtgcggcaacccgatatgaccttcggg
gcgcaagattgccattatgatgaaagtggttcgcataccggctgtgtttcggcaccgatg
ctccgtgaggtcggtgcaagttatgtcatcgttggccatagcgaaagacgtattgaacag
aatgaaaccaatgaagagatccgagcaaaaacgacaacggcgatagccaatggccttgtg
acgattgtctgtattggcgaatcccgtgctgcccacgcatcggggcaggctttgcctatt
atcggggcgcagctggatggctgtattccgcccgatgccaccagcgataatctcgttgtt
gcctatgaacccatctgggctatcggaacgggtaataccccaccgcctgaaagcattgcc
gaaatgcacgcctcgattcgtgaccgcttgtgcttgttattaggaagcgaagggaagaag
gtccgcatcttatatggaggctctgttaccggcaaaaatgccgaagaattgatggccatt
ccagatgtcaatggaacccttgtcggtggtgccagccttaccgcagaacaatttgttcct
atcattgaagctgggggacgtttagcctag

DBGET integrated database retrieval system