KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0510Help
Entry
ZMO0510           CDS       T00221                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:zmo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:zmo00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:zmo00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:zmo00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
509031..510353
Genome map
AA seq 440 aa AA seqDB search
MSIEVKMPALSPTMTEGTLAKWLVKEGDAVKAGDILAEIETDKAIMEFETVDAGIIAKIL
VPEGSENIAVGQVIAVMAEAGEDVSQVAASASSQISEPSEKADVAQKETADSETISIDAS
LDKAISNAGYGNKTENMTASYQEKAGRIKASPLAKRLAKKNHVDLKQVNGSGPHGRIIKA
DIEAFIAEANQASSNPSVSTPEASGKITHDTPHNSIKLSNMRRVIARRLTESKQNIPHIY
LTVDVQMDALLKLRSELNESLAVQNIKISVNDMLIKAQALALKATPNVNVAFDGDQMLQF
SQADISVAVSVEGGLITPILKQADTKSLSALSVEMKELIARAREGRLQPQEYQGGTSSIS
NMGMFGIKQFNAVINPPQASILAIGSGERRPWVIDDAITIATVATITGSFDHRVIDGADA
AAFMSAFKHLVEKPLGILAQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattgaagtcaaaatgccagcgctttcgcctacaatgacagaaggcacccttgcg
aaatggctggtgaaagaaggggatgccgttaaggcgggcgatattctggccgaaatcgaa
accgataaagcgattatggaatttgaaacggttgatgcagggatcatcgctaaaattcta
gtgccggaaggtagtgaaaatattgctgtaggtcaggtgattgctgtcatggccgaagcg
ggcgaagatgtttctcaagtcgccgcttctgcttcatcccagatatcagaaccttctgaa
aaagcagatgtcgcacagaaagagacggcagatagtgaaacgatatccatcgatgcctct
ctcgataaggcaatcagcaacgcaggttatggcaacaaaacagagaatatgacggcttcc
tatcaagaaaaagcagggcggataaaagccagtcctttggccaagcgcttggctaagaaa
aaccatgttgacctgaaacaggtaaacggtagtggcccccatgggcggattatcaaagct
gatattgaagccttcattgctgaggctaatcaagcctcttctaatccgtcagtctctacg
ccggaagcctccggtaaaataacgcatgatacgccccataatagcatcaagcttagcaat
atgcggcgcgttattgctcgtcgtctgactgaatccaaacaaaatattcctcacatctac
ttgacggttgatgtccagatggatgctcttttgaagctccgctctgagctcaatgaatcc
ttagctgttcagaatattaaaatctcagtcaatgacatgctgattaaggctcaggcttta
gccttaaaagcaacgcctaacgtcaatgttgcttttgatggcgatcagatgctgcaattc
tcacaggccgatatctctgtcgctgtctctgttgaaggtgggctgattacgcctatcttg
aaacaagctgataccaaaagcttgtctgcgctttctgtcgaaatgaaagagcttattgct
cgcgcaagggaagggcgcttgcaacctcaggaatatcagggcggaacgtccagtatttct
aatatggggatgtttggtatcaagcagtttaatgctgtcatcaacccgccacaggcctct
attttagcgattggaagcggtgaaagacggccttgggtgattgatgatgcgatcaccatt
gctaccgttgcaactatcaccggtagttttgatcatcgtgttattgatggtgccgatgcg
gctgcctttatgtcagccttcaagcatttggttgaaaaaccattagggattttagcacaa
tga

DBGET integrated database retrieval system