KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0510Help
Entry
ZMO0510           CDS       T00221                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo00020  Citrate cycle (TCA cycle)
zmo00620  Pyruvate metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01130  Biosynthesis of antibiotics
zmo01200  Carbon metabolism
Module
zmo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO0510
   00020 Citrate cycle (TCA cycle)
    ZMO0510
   00620 Pyruvate metabolism
    ZMO0510
Enzymes [BR:zmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ZMO0510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AAV89134
UniProt: O66119
Position
509031..510353
Genome map
AA seq 440 aa AA seqDB search
MSIEVKMPALSPTMTEGTLAKWLVKEGDAVKAGDILAEIETDKAIMEFETVDAGIIAKIL
VPEGSENIAVGQVIAVMAEAGEDVSQVAASASSQISEPSEKADVAQKETADSETISIDAS
LDKAISNAGYGNKTENMTASYQEKAGRIKASPLAKRLAKKNHVDLKQVNGSGPHGRIIKA
DIEAFIAEANQASSNPSVSTPEASGKITHDTPHNSIKLSNMRRVIARRLTESKQNIPHIY
LTVDVQMDALLKLRSELNESLAVQNIKISVNDMLIKAQALALKATPNVNVAFDGDQMLQF
SQADISVAVSVEGGLITPILKQADTKSLSALSVEMKELIARAREGRLQPQEYQGGTSSIS
NMGMFGIKQFNAVINPPQASILAIGSGERRPWVIDDAITIATVATITGSFDHRVIDGADA
AAFMSAFKHLVEKPLGILAQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattgaagtcaaaatgccagcgctttcgcctacaatgacagaaggcacccttgcg
aaatggctggtgaaagaaggggatgccgttaaggcgggcgatattctggccgaaatcgaa
accgataaagcgattatggaatttgaaacggttgatgcagggatcatcgctaaaattcta
gtgccggaaggtagtgaaaatattgctgtaggtcaggtgattgctgtcatggccgaagcg
ggcgaagatgtttctcaagtcgccgcttctgcttcatcccagatatcagaaccttctgaa
aaagcagatgtcgcacagaaagagacggcagatagtgaaacgatatccatcgatgcctct
ctcgataaggcaatcagcaacgcaggttatggcaacaaaacagagaatatgacggcttcc
tatcaagaaaaagcagggcggataaaagccagtcctttggccaagcgcttggctaagaaa
aaccatgttgacctgaaacaggtaaacggtagtggcccccatgggcggattatcaaagct
gatattgaagccttcattgctgaggctaatcaagcctcttctaatccgtcagtctctacg
ccggaagcctccggtaaaataacgcatgatacgccccataatagcatcaagcttagcaat
atgcggcgcgttattgctcgtcgtctgactgaatccaaacaaaatattcctcacatctac
ttgacggttgatgtccagatggatgctcttttgaagctccgctctgagctcaatgaatcc
ttagctgttcagaatattaaaatctcagtcaatgacatgctgattaaggctcaggcttta
gccttaaaagcaacgcctaacgtcaatgttgcttttgatggcgatcagatgctgcaattc
tcacaggccgatatctctgtcgctgtctctgttgaaggtgggctgattacgcctatcttg
aaacaagctgataccaaaagcttgtctgcgctttctgtcgaaatgaaagagcttattgct
cgcgcaagggaagggcgcttgcaacctcaggaatatcagggcggaacgtccagtatttct
aatatggggatgtttggtatcaagcagtttaatgctgtcatcaacccgccacaggcctct
attttagcgattggaagcggtgaaagacggccttgggtgattgatgatgcgatcaccatt
gctaccgttgcaactatcaccggtagttttgatcatcgtgttattgatggtgccgatgcg
gctgcctttatgtcagccttcaagcatttggttgaaaaaccattagggattttagcacaa
tga

DBGET integrated database retrieval system