KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0545Help
Entry
ZMO0545           CDS       T00221                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01130  Biosynthesis of antibiotics
zmo01230  Biosynthesis of amino acids
Module
zmo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZMO0545
Enzymes [BR:zmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ZMO0545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS Phage_TAC_9
Motif
Other DBs
NCBI-ProteinID: AAV89169
UniProt: Q5NQ36
Position
complement(537409..538203)
Genome map
AA seq 264 aa AA seqDB search
MSNILTEICATKAEFVAERKKQIGNNALLDLIKAQTQPRGFRAALEKKRARGQFGLIAEI
KKASPSKGLIRSDFTPAAHARDYEEGGAACLSVLTDRPYFQGHEDYLIAARQAVKLPVLR
KDFMIDPWQVTEARAIGADAILIIVAALDDQQMQDIEAAALEYGIDALVEVHSHDEMERA
LKLKSRLIGVNNRDLRDFSVSFDRTYELVGSAPKDCTFVAESGIRNHDDLVAMQRHDIGC
FLVGETLMRQDDLRKATKDLLGLS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatattcttacagagatctgcgccaccaaggcagaattcgtggcagaacgaaaa
aaacagattgggaataatgcccttcttgatttgataaaggcacagacgcaaccccgtggt
tttcgagctgccctagaaaaaaagagagcgcgagggcaattcgggcttattgcagaaatc
aaaaaagcaagtccttcaaaagggttaatccgttctgattttacaccagcagcccatgcc
cgtgactatgaagaaggcggtgcagcctgtttatccgttttaacagatcgcccctatttc
caaggccatgaagattatttaatcgcggccagacaagcggtaaagttacccgtccttcgt
aaagattttatgattgacccgtggcaggtaaccgaagctagagccatcggtgccgatgcg
atcttgattatcgttgcggccttggacgatcagcagatgcaggatattgaagccgccgct
ttggaatatggcatagatgctttggtagaagtccatagtcatgatgagatggagcgggcg
ttaaaattgaaatcccgtcttattggcgtcaataatcgcgatttgcgagacttttcggtc
agttttgaccgcacctatgaattagtgggttcagcccccaaagattgcacctttgttgcg
gaaagcggtatccgcaatcatgatgatttggtggctatgcagcgtcatgacattggttgt
tttttagtaggtgaaactttaatgcggcaagatgatctgagaaaagccacaaaggattta
ttgggattatcctaa

DBGET integrated database retrieval system