KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0552Help
Entry
ZMO0552           CDS       T00221                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:zmo00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(546926..547507)
Genome map
AA seq 193 aa AA seqDB search
MAKLYFYYASMNAGKSTNLLQADFNYRERGMQTLLFTAGIDTRYKQGVIKSRIGLEAPAI
AFFEESSLWDIIQEQHVKNPLHCILIDEAQFLNKNQVFELARVCDDLNIPVLCYGLRTDF
QAELFEGSKYLLAIADKLAEIKSVCFCGAKATMNLRVDENKKPIRHGQQTEIGGNERYIA
LCRRHFIEKLNSL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctaagttgtatttttattatgcctcgatgaacgccggaaaatcgacaaatcttttg
caagcggatttcaattatcgtgaacgagggatgcaaaccttattgttcacagccggaatt
gatacccgctataaacagggtgtcataaaatcccgtatcggtttagaagcgcccgctatc
gcgttttttgaggaaagctctctatgggatattatccaagagcagcatgttaaaaatccg
ctgcactgtatcttgatagatgaagcgcaattcctgaacaaaaatcaggtatttgaactt
gcccgcgtctgtgacgatttgaacattccagttttatgttacggtcttcgcactgacttt
caggctgaattatttgaaggctcgaaatatctgctggcgattgcggataaattggcagaa
atcaaatcggtctgtttttgcggtgccaaggcgacaatgaatttacgggttgatgaaaat
aaaaagcccattcgtcatggacaacaaacggaaatcggagggaacgagcgctatatcgcg
ctttgccgccgccattttatagaaaaacttaatagcttatga

DBGET integrated database retrieval system