KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0552Help
Entry
ZMO0552           CDS       T00221                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ZMO0552
Enzymes [BR:zmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ZMO0552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(546926..547507)
Genome map
AA seq 193 aa AA seqDB search
MAKLYFYYASMNAGKSTNLLQADFNYRERGMQTLLFTAGIDTRYKQGVIKSRIGLEAPAI
AFFEESSLWDIIQEQHVKNPLHCILIDEAQFLNKNQVFELARVCDDLNIPVLCYGLRTDF
QAELFEGSKYLLAIADKLAEIKSVCFCGAKATMNLRVDENKKPIRHGQQTEIGGNERYIA
LCRRHFIEKLNSL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctaagttgtatttttattatgcctcgatgaacgccggaaaatcgacaaatcttttg
caagcggatttcaattatcgtgaacgagggatgcaaaccttattgttcacagccggaatt
gatacccgctataaacagggtgtcataaaatcccgtatcggtttagaagcgcccgctatc
gcgttttttgaggaaagctctctatgggatattatccaagagcagcatgttaaaaatccg
ctgcactgtatcttgatagatgaagcgcaattcctgaacaaaaatcaggtatttgaactt
gcccgcgtctgtgacgatttgaacattccagttttatgttacggtcttcgcactgacttt
caggctgaattatttgaaggctcgaaatatctgctggcgattgcggataaattggcagaa
atcaaatcggtctgtttttgcggtgccaaggcgacaatgaatttacgggttgatgaaaat
aaaaagcccattcgtcatggacaacaaacggaaatcggagggaacgagcgctatatcgcg
ctttgccgccgccattttatagaaaaacttaatagcttatga

DBGET integrated database retrieval system