KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0584Help
Entry
ZMO0584           CDS       T00221                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZMO0584 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZMO0584 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZMO0584 (trpA)
Enzymes [BR:zmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ZMO0584 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(585239..586063)
Genome map
AA seq 274 aa AA seqDB search
MSRIANTFAKTKKENRAALIAFLTAGDPSIEATPALLDSLVENGVDIIELGMPFSDPMAD
GPAIQKANLRALAAKTGYNDIFRIATEFRKRHPETPLILMGYANPMTFKGSDSFAASAKE
AGVDGIICVDIPPEEDATLGVAVREKGMDMIRLATPTSDEARLKIILDGASGFLYYVSVA
GVTGLQQATEASIDAALDRIKAVTDLPVAVGFGIRSPEQAAAIAKKADAVVVGSAFVSCI
EKAVTNRQDPNAALEKLAKELSTAISDARKEAAL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagccggattgccaatacttttgccaaaacaaaaaaagaaaatcgggctgctttgatt
gcctttctgacggcaggtgatccctctattgaagcgacccctgccctgttggatagtctg
gttgaaaatggcgtcgatattatcgaattagggatgcctttttctgatccgatggcagat
ggccccgctattcagaaagccaatcttcgggctttggcggctaaaactggctataatgac
atctttagaatagccacggaatttagaaaacggcatccagaaacgccgcttatccttatg
ggatatgccaatccgatgacgtttaaaggcagcgacagcttcgccgcctctgcaaaagaa
gccggtgttgacggcattatctgtgtcgatattccgccagaagaagacgcaacccttggt
gtcgcagtgcgcgaaaaaggcatggatatgatccggctcgccaccccgaccagcgatgaa
gcgcgtttaaaaatcatcctcgatggggcttccggtttcctctattatgtttctgtcgcg
ggcgttacgggtctgcaacaggcaactgaagccagcattgatgccgcgcttgatcggatt
aaagctgtaacagatttgccggttgctgtcggtttcggtattcgttcaccagaacaggcc
gcagcgattgccaaaaaggctgatgcggttgtggtgggttcggcctttgtgtcttgcatc
gaaaaggctgtgaccaatcgccaagatcccaatgcagccttagagaaattggctaaagaa
ttaagcacggccatttccgatgcccgtaaggaggccgccctatga

DBGET integrated database retrieval system