KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0585Help
Entry
ZMO0585           CDS       T00221                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZMO0585
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZMO0585
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZMO0585
Enzymes [BR:zmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ZMO0585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(586060..587286)
Genome map
AA seq 408 aa AA seqDB search
MKQSNSVLPNSLRAQPDAGGHFGTFGGQYVPETLMPLILELNQEYRRALKDPSFIAERDD
LLEHYVGRPSPLYFAPRLTEAWGGAKIYLKREDLNHTGAHKINNCIGQVLLAKRMGKTRV
IAETGAGQHGVATATVAARFGLSCTVFMGELDTERQQPNVFRMKLLGAEVRPVKAGSRTL
KDAMNEALRDWVAHIDDTFYILGTAAGPHPYPEMVRDFQSVIGREAREQIQKAEKRLPDL
LIAAVGGGSNAMGLFHPFLDDTDVAMIGVEAAGEGMETGRHAASLTGGAPGIVHGNRTYL
LYDENGQIKDAHSISAGLDYPGIGPEHSWLKDIKRVRYETITDNEALAAFQQLCRLEGII
PALESSHALAEAAKIAPTMGKDKVIIVNLSGRGDKDIYTVASHLGVAL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatctaattctgttcttccgaattctcttcgcgcccaacctgatgcaggaggg
cattttggcacattcggcggacaatatgttcccgaaaccctgatgcctttaattcttgag
cttaatcaggaatatcggcgcgcattgaaagacccgtcattcatagcagaaagagatgat
ctgctagagcattatgtcggtcgtcctagcccgctttatttcgcgcctcgcctgacagaa
gcctggggcggcgcaaaaatctatttgaagcgtgaagatcttaatcacacgggtgcgcat
aaaatcaataactgcatcggtcaggtcttattagcgaaaagaatgggtaaaacccgcgtt
atcgcggaaaccggtgccggacagcatggtgtcgcaacggcgaccgttgcggctcgtttt
ggtctatcttgcacggtctttatgggtgaactggatacagagcgccagcaacccaatgtc
tttagaatgaaattgttaggtgccgaggttcgtcccgttaaggcgggttcccgcaccttg
aaagatgccatgaatgaagccctgcgtgattgggtggctcatattgatgacactttctat
attcttggcacggcagcaggcccccatccctatcctgaaatggtgcgtgatttccaatcc
gtgattggacgcgaagccagagagcagattcaaaaagcagaaaagcgtttaccggattta
ttgatcgcagccgttggcggtggatcaaatgctatggggcttttccatcctttccttgat
gatacagatgtcgctatgattggtgtcgaggccgccggtgaaggcatggaaaccggtcgt
catgcagccagcttaacgggcggcgcaccgggtatcgtccatggaaaccgcacctatctt
ctttatgatgagaatggtcagattaaagatgcccattcaatttcagccggtcttgattat
ccgggtattggccctgaacatagctggttaaaagacataaaacgtgtccgttatgaaacc
attacggataacgaagccttggccgctttccagcagctttgccgattagagggcattatt
ccggcattggaatcttcccatgctttggcagaagccgccaaaatagccccgacaatgggc
aaagacaaagtcattattgttaatctttcagggcgtggcgacaaagatatctataccgta
gccagccatttaggggtcgcgttatga

DBGET integrated database retrieval system