KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0734Help
Entry
ZMO0734           CDS       T00221                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:zmo00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
734689..735507
Genome map
AA seq 272 aa AA seqDB search
MLLSSLSPQAALLEGLVQIALQAGKRALEIYHGDFTVMKKDDDSPVTQADREAEAIILQG
LKKLQPGVAVIAEEEYAKTKKGYNTDSFFLVDPIDGTQEFVNKRDEFTVNIALIKKAYPI
LGVIYAPAINRLYVGDVLAKTAWAADTTEDFQIENRNSIQIREAGEKWDVMTSFSHNNPA
TEAYLKQLPIENRIKAGSSLKLCLLAEGKADIYPRLSPTHEWDTAAGHAILLAAGGNVID
ETGENLTYGKPGYRNPGFIAYGSEQPPLPVEK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcttttatcatcactttcgccgcaggctgcgttattagaaggtctggtacaaattgcg
ctacaggccggaaaacgggcgctcgaaatttatcatggtgatttcaccgtgatgaagaaa
gatgacgatagccccgtaacgcaggcggatcgggaagctgaagcgattattttacaggga
ttgaaaaagctgcaacccggtgttgccgtcatcgcagaagaagaatacgccaaaaccaag
aaggggtataataccgacagctttttcttggttgatcccattgatggcacgcaggaattt
gtgaataagcgtgatgaattcacggtcaatattgccctgattaaaaaggcctatcctatt
ttaggtgtgatctatgcgccggcaatcaaccgcctttatgtcggcgatgtgttggctaaa
acggcatgggccgctgatacgactgaagatttccagattgaaaaccggaatagcattcaa
atccgtgaagcgggtgaaaaatgggatgtaatgacctctttttcccataataaccctgca
accgaggcctatttgaagcagttaccgatcgaaaatcggattaaggccggttcttctttg
aaattatgtttattggcagaaggaaaagcggatatttatccccggttatcgcctacccat
gaatgggatacggctgcgggtcatgccattcttttggccgcagggggtaatgtgatcgac
gagacgggggaaaatctgacctatgggaaaccgggttatcgcaaccccggctttatcgcc
tatggatcggagcagccgcctttacctgtagaaaaataa

DBGET integrated database retrieval system