KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0812Help
Entry
ZMO0812           CDS       T00221                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ZMO0812 (recR)
DNA repair and recombination proteins [BR:zmo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ZMO0812 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
814331..814927
Genome map
AA seq 198 aa AA seqDB search
MSASPIENLIKSLAVMPGLGPRSARRAALYLIKKRETALYNLAQALDEVQQSLVICPECG
NIDSCNPCSICSDPKRDDALLCVVEEVADLWALDRSRLFAGRFHVLGGRLSALDGITPED
LSIDALVKRVQSGKIKEVVLAMNATLEGQTTAHYITDCLEKYPVRITQLAHGLPVGGELD
YLDDGTLAQALRARRPVS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttctcctatagaaaatcttatcaagagtctggcggttatgcccggattgggc
ccgcgatcagcaaggcgggcggcgttgtatctgattaaaaagagagaaaccgcactttat
aatctggcgcaggctttggacgaggtgcagcagtcgctggttatctgccccgaatgtggc
aatattgatagctgcaatccttgttcgatctgttccgaccccaagcgggatgatgccttg
ctgtgtgtggttgaagaggttgctgatttatgggcgcttgatcggtcacgtctatttgcg
ggacgctttcatgtccttggcgggcggttatcggccttggatgggataacgcccgaagat
ctgtcgattgatgcccttgtgaagcgggttcaatcggggaaaattaaagaggttgtcttg
gccatgaatgccacgttagaaggccagacgaccgcgcattatataacggattgtttagaa
aaatatccggtaagaattacccaattggcgcatggtcttcctgtaggaggggagcttgac
tatttagatgatggcactttagcgcaagctttgcgtgccagacgacctgtatcatga

DBGET integrated database retrieval system