KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0812Help
Entry
ZMO0812           CDS       T00221                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ZMO0812
DNA repair and recombination proteins [BR:zmo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     ZMO0812
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ZMO0812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
814331..814927
Genome map
AA seq 198 aa AA seqDB search
MSASPIENLIKSLAVMPGLGPRSARRAALYLIKKRETALYNLAQALDEVQQSLVICPECG
NIDSCNPCSICSDPKRDDALLCVVEEVADLWALDRSRLFAGRFHVLGGRLSALDGITPED
LSIDALVKRVQSGKIKEVVLAMNATLEGQTTAHYITDCLEKYPVRITQLAHGLPVGGELD
YLDDGTLAQALRARRPVS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttctcctatagaaaatcttatcaagagtctggcggttatgcccggattgggc
ccgcgatcagcaaggcgggcggcgttgtatctgattaaaaagagagaaaccgcactttat
aatctggcgcaggctttggacgaggtgcagcagtcgctggttatctgccccgaatgtggc
aatattgatagctgcaatccttgttcgatctgttccgaccccaagcgggatgatgccttg
ctgtgtgtggttgaagaggttgctgatttatgggcgcttgatcggtcacgtctatttgcg
ggacgctttcatgtccttggcgggcggttatcggccttggatgggataacgcccgaagat
ctgtcgattgatgcccttgtgaagcgggttcaatcggggaaaattaaagaggttgtcttg
gccatgaatgccacgttagaaggccagacgaccgcgcattatataacggattgtttagaa
aaatatccggtaagaattacccaattggcgcatggtcttcctgtaggaggggagcttgac
tatttagatgatggcactttagcgcaagctttgcgtgccagacgacctgtatcatga

DBGET integrated database retrieval system