KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0867Help
Entry
ZMO0867           CDS       T00221                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
875692..876705
Genome map
AA seq 337 aa AA seqDB search
MQDHNQVNKEKPVLVTGVSGFVGSAVARSLAQQGYKVRGMVRATSPKTNIRDFPGEIVFG
DLDDPPSLREPLSGCGALIHVAADYRLWAADPNEIIRHNRLHTQAIMTAALYLGIERVIY
TSSVATLAPGHGKPSDENSPLMPENAIGAYKRSKVEAERLVEKMIAEQGLPAVIVNPSTP
IGPRDVKPTPTGRIIIEAATGKMPAYVNTGLNLAHVDDVADGHVKALEKGVIGERYILGG
ADVPLSVMLAEIARQVGRKPPKVALPRWPLFPLAWGAEAFAKITKKEPFITSDALRMAGY
HMYFSSEKAKRDLGYKSRPWQHAISDAIEWFRAEGML
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagatcataatcaggtgaacaaagagaagcctgtattagttactggagtttctgga
tttgtgggttctgcggttgcgcgttcattagcgcagcagggctataaagtgcgaggcatg
gtacgtgcgaccagcccgaaaaccaatatccgtgactttcccggcgagattgtttttggt
gatctggatgatccgccttctttaagagaacccctttcaggctgtggcgcgctgatccat
gtagcagctgattatcgtttatgggccgccgatcctaacgaaattattcgtcataaccgt
ttgcatacccaagcgatcatgacagcggcgctctatctgggtatcgagcgcgtgatctat
accagtagtgtcgctactttggcaccgggacatggtaaacccagcgatgagaattctccg
ctaatgccggaaaatgctattggtgcctataaacgctccaaggttgaagccgaacgtctg
gttgaaaagatgatagcagagcagggcttgcctgcggttattgttaatccttcaacgcct
attggcccaagggatgttaagcctacgcccaccggacgtattattatcgaagcggctacc
ggaaaaatgcccgcctatgtcaatacagggcttaatcttgctcatgtggatgacgtagca
gatgggcatgttaaagcccttgaaaaaggcgttatcggtgagaggtatattttagggggc
gccgatgtgcctttaagtgtcatgttggctgaaatcgcgcgacaggtaggtcggaagcca
ccaaaagtcgctttgccaagatggccgctctttccattggcatggggcgcagaagccttt
gctaagataacgaaaaaagaacctttcattaccagtgatgccttgcgcatggctggctat
catatgtatttttcgtcggagaaagccaaacgcgatctgggttacaaatcccgtccgtgg
caacatgccatttctgatgccatcgaatggtttcgggcagaaggtatgttgtga

DBGET integrated database retrieval system