KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0872Help
Entry
ZMO0872           CDS       T00221                                 

Definition
squalene-hopene cyclase
Orthology
K06045  
squalene-hopene/tetraprenyl-beta-curcumene cyclase [EC:5.4.99.17 4.2.1.129]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Sesquiterpenoid and triterpenoid biosynthesis
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Sesquiterpenoid and triterpenoid biosynthesis [PATH:zmo00909]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
880832..882808
Genome map
AA seq 658 aa AA seqDB search
MTVSTSSAFHHSPLSDDVEPIIQKATRALLEKQHQDGHWVFELEADATIPAEYILLKHYL
GEPQDLEIEAKIGRYLRRIQGEHGGWSLFYGGDLDLSATVKAYFALKMIGDSPDAPHMLR
ARNEILARGGAMRANVFTRIQLALFGAMSWEHVPQMPVELMLMPEWFPVHINKMAYWART
VLVPLLVLQALKPVARNRRGILVDELFVPDVLPTLQESGDPIWRRFFSALDKVLHKVEPY
WPKNMRAKAIHSCVHFVTERLNGEDGLGAIYPAIANSVMMYDALGYPENHPERAIARRAV
EKLMVLDGTEDQGDKEVYCQPCLSPIWDTALVAHAMLEVGGDEAEKSAISALSWLKPQQI
LDVKGDWAWRRPDLRPGGWAFQYRNDYYPDVDDTAVVTMAMDRAAKLSDLRDDFEESKAR
AMEWTIGMQSDNGGWGAFDANNSYTYLNNIPFADHGALLDPPTVDVSARCVSMMAQAGIS
ITDPKMKAAVDYLLKEQEEDGSWFGRWGVNYIYGTWSALCALNVAALPHDHLAIQKAVAW
LKTIQNEDGGWGENCDSYALDYSGYEPMDSTASQTAWALLGLMAVGEANSEAVTKGINWL
AQNQDEEGLWKEDYYSGGGFPRVFYLRYHGYSKYFPLWALARYRNLKKANQPIVHYGM
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgactgtatcgacttcctcggcttttcatcatagcccgttgtctgatgatgttgagccg
attatccaaaaggccacccgtgccttgcttgagaagcagcatcaggatggccattgggtt
tttgaattggaagccgatgcaaccattcccgctgaatacatcctgttaaagcattatttg
ggtgaaccccaagatttagaaatagaggccaagataggtcgctatttgcgtcgtattcag
ggcgagcatggcggatggtctttgttttatggtggtgatcttgatttgagcgccacggtc
aaagcctattttgccttgaaaatgatcggagattctcctgatgcgcctcatatgcttcga
gccagaaatgaaattttggcacggggtggggcgatgcgtgccaatgtctttacacgtatt
caattagctctgttcggggcaatgtcatgggagcatgtccctcaaatgcccgtagagttg
atgttgatgccggaatggtttccggttcacatcaataaaatggcctattgggcaagaacc
gttttagtcccgttattggttttacaggcgttaaagcctgtcgcccgtaatcggcgcggt
atcttggttgatgaattatttgtgccggatgttttaccgacccttcaggaaagcggtgac
cctatatggcgtcgttttttttcggcacttgataaggtattgcataaagtagaaccttat
tggccgaaaaatatgcgcgcgaaggctattcatagctgtgtccattttgtgaccgagcgt
ttgaatggtgaagacgggttgggtgctatttatccggcgattgccaatagcgtcatgatg
tatgatgccttgggatatcccgaaaaccatccagaaagagccattgcccgtcgggctgtc
gaaaaattgatggtgttagatggcacggaagatcagggtgataaagaagtctactgtcag
ccttgtttatccccgatttgggatacggctttggttgcccatgccatgttggaagtcgga
ggcgatgaggctgaaaaatcggctatttctgccctgagctggttaaagccgcaacaaatt
ttggatgtaaagggcgattgggcatggcggcggcctgatctccgacccgggggatgggcc
tttcaatatagaaatgactattatcccgatgtcgatgatacggctgttgtgactatggcg
atggatcgagccgcaaaattgtcggatcttcgcgatgattttgaggaatctaaagcgcgt
gccatggaatggaccattgggatgcaaagcgataatggcggttggggtgctttcgatgcc
aataacagctatacttatctgaataatattccctttgctgatcatggcgcgttacttgat
ccgccaacggtcgatgtctcggcacgctgcgtttcaatgatggcgcaagccggtatctcg
attacagatcccaaaatgaaagcggcagttgattatcttctgaaagagcaagaagaggat
ggtagctggttcgggcgttggggtgtcaattacatatatggcacatggtcggccttatgt
gcattgaatgtggccgctttaccccatgatcatttagctattcagaaagctgtggcttgg
ctgaaaactattcaaaatgaagatggtggttggggtgaaaattgcgatagctatgccctt
gattatagcggatacgagccgatggattcgacggcttcccaaacagcatgggctttattg
ggcttgatggctgttggggaagctaattccgaggccgtgacaaagggtataaactggttg
gcacaaaatcaggatgaagaaggattgtggaaagaagattattatagtggcggtggtttc
ccccgtgttttttatcttcggtatcacggttattccaaatattttcctctttgggcttta
gcgcgctatcgcaatttgaaaaaagccaatcagccgattgttcattatgggatgtaa

DBGET integrated database retrieval system