KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0880Help
Entry
ZMO0880           CDS       T00221                                 

Definition
CheA signal transduction histidine kinase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:zmo02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:zmo02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(888599..890272)
Genome map
AA seq 557 aa AA seqDB search
MTQPEKKLFTLWQAQKKTIENDLKACQAGIYDSKCLLRLEMAIKELNNQASGNNETALVQ
LTFLLAQLIEAIRKDRLALNLFLIDLIQRSFDTIENYILAITSKQIPVDQTQIEEELQKT
IAHSSQYAIKKVGHEITIDKPEVILSKNALVADDPVTRIHQNATDETLHVEGSLEPHIPV
NPEKLDNLFDIFHEMLSIRSELSLTHGLSDEKAGRVNALEKLDQLIQSANNYAMALQTQT
IEPLFKQVIDIIKQRCGNNHKNIIFSVIGSEIKIDKRIVIDLGKALLELVDNAAFHGIEE
SETRQEMGKPREGHIRLEARYHASRLKIIIADDGRGILWEKLVKIAEQYGIIADKDAPDG
KADETQSFESHASHHGKGGFATVKDIVQSLKGEIRIYAPPRLGTRVTMLLPLNQTMVEGL
ITTVKDQSYILPISDIVESIAVNAEDIHWVDERQSMIQLRDQWFPAIALSALLGEENFTQ
DSFKTGRKILIRIDPTIHQPEVMIIVDALESQRQVLVQSLEKNFQAVHGISGVAFLQEGQ
TALVVDIDSLLNPHKYS
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcccgaaaaaaaactgtttactttatggcaagcccaaaaaaaaacgatcgaa
aatgatctaaaggcctgtcaggccggtatctatgacagcaaatgcctgctccgtctggaa
atggcgataaaagaactgaataatcaggcctctggcaataatgaaacagcgttagttcag
ttaacttttttactagcgcaactgatagaagcgatccgcaaagatcgcttggccttaaat
ctgttcttaattgatcttatccagcgtagttttgatacgatcgagaattacattctggcc
attacatcaaaacagattccggttgaccagacccagattgaagaagaattacaaaagaca
atcgcccattcttctcaatatgcgattaaaaaagtcggtcatgaaatcactatagacaag
ccagaagtcattttatccaaaaacgctctggtggccgatgatcccgtaacgcgtattcat
caaaatgccacagatgaaacgcttcacgttgaaggcagtcttgaaccgcatattccagtt
aatcctgaaaaactggataatctattcgatatattccacgaaatgcttagcattcgttca
gaattaagtctcactcatggcctttcagatgaaaaagctggtcgggtcaatgcgctcgag
aaattggatcaactgatccaatctgccaataattatgctatggcgctccaaactcagact
atcgagccgctttttaaacaagtcattgatatcattaagcaaagatgcggtaataatcac
aaaaatatcattttttcagttatcggatctgaaatcaaaatcgacaaacggatcgtcatt
gatcttggcaaggctttacttgaacttgtcgataatgcggcctttcacggcattgaagaa
agcgaaacacgtcaggaaatgggtaaacctcgcgaaggtcatattcgcttggaagcccgc
tatcatgccagccgcttaaagatcattatcgccgatgatggccgtggcattctttgggaa
aaactggtcaaaatcgccgaacaatacggcataattgcagataaagatgctccagatggg
aaagcagacgaaacgcaatcttttgaaagccatgcctcgcatcatgggaaaggcggcttt
gcgaccgtcaaagacattgttcagtcattaaagggagaaatacgcatttatgcccctccc
cgtttaggcacgcgggtcacgatgcttctaccccttaatcaaacgatggttgaaggcctg
attaccaccgtcaaagatcaaagctatatcctgcctatctccgatatcgtcgaaagcatc
gcggtcaacgcagaagatattcattgggtcgatgaaagacagtcgatgatccaactacgg
gatcaatggtttccggctattgcgctttctgccttattgggagaggaaaatttcacacag
gattcttttaagacaggccgaaaaatcctgatcagaattgacccgacgattcaccaacca
gaagtgatgattatcgttgatgctcttgaaagccaaagacaggttttagttcaaagcctc
gaaaaaaatttccaagctgtgcacggtattagtggggttgcttttctacaagaaggtcaa
acggctctagttgttgacatagactccttattaaaccctcacaaatacagttaa

DBGET integrated database retrieval system