KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO0938Help
Entry
ZMO0938           CDS       T00221                                 

Definition
type I phosphodiesterase/nucleotide pyrophosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ZMO0938
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ZMO0938
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ZMO0938
Enzymes [BR:zmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ZMO0938
Exosome [BR:zmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ZMO0938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
955327..957057
Genome map
AA seq 576 aa AA seqDB search
MNSLLHHSFLKTVFSSLAIAIVTSSLSSVTIAATHPLDNHPKGEIAASSETAHNPWSGTR
LIVAISVDQFSSDLFSEYRGRFRSGMKQLQNGVVYPMAYHSHAATETCPGHSVLLTGDHP
ARTGIIANNWYDFSVKRADKKVYCSEDPSLSADPQNYQPSVHYLKVPTLGDRMKKANPHS
RVISVAGKDRAAIMMGGHMTDQIWFWSDNAYKTLADHKGEMPVTVKTVNEQVTRFMQQDE
APVMPSVCADHASALKIGNNRIIGLAPASRKAGDFKTFRVTPDYDRTTTDIAIGLIDELK
LGHGNAPDLLTVSLSATDAVGHAYGTEGAEMCSQMAGLDDNIARIIAALDSNGVPYVLVL
TADHGGQDVPERAKLRGVETAQRVDPALSPDQLSLRLAERFQLSHNQPLFFANEPQGDWY
INRNLPEQTKAQLIQAAKSELSNHPQVAAVFTASELTHIPYPTRSPELWNLAERAKASFD
PLRSGDLIVLLKPRVTPIAKPVSYVATHGSAWDYDRRVPIIFYTPHASGFEQPMPVETVD
IMPSLAALLQIPLRKGEVDGRCLDLDPTEATTCPVK
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgaactcattgcttcatcattcttttttaaagaccgtattttcttcgttggcgatagcg
atagttacaagcagtctttcatcggtaacaatcgcggcaacgcatcctttggataatcat
cccaagggagagattgccgcgtcttctgaaacagcgcataacccatggagtgggacgcgc
ctgatcgttgctatttctgttgatcaattttcgtctgatttattttctgaatatcgtggc
cgcttccggtcaggaatgaagcagttacaaaatggtgtcgtctatcccatggcttaccat
agtcatgcggcaacggagacctgtcctggacattcggttttgttaacaggcgatcatcca
gccagaacgggaattattgccaataactggtatgatttttcggtcaaaagggctgataaa
aaggtctattgtagtgaagacccgtctctttcagctgatcctcagaattaccaaccatcc
gttcattatttaaaagtgccgactttgggtgatcggatgaaaaaagcgaatccccatagc
cgtgtaatttctgtagcgggcaaagatcgtgccgccattatgatgggtggccatatgaca
gatcaaatatggttttggtctgataatgcgtataaaacgctggctgatcataagggggag
atgcctgtcactgtaaaaacagtgaatgaacaagtaacccgttttatgcagcaagatgag
gcgcctgttatgccttctgtttgtgcggatcacgcatcggctctgaaaatcgggaataac
agaattatcggcttggcaccggcatccagaaaagccggtgatttcaagacttttcgagta
acccccgactatgatcggacaactaccgatattgctatcggattgattgatgagttgaaa
ttagggcatggcaatgcccccgatctgttaacggtgagtttgtctgcaacggatgctgtc
ggccatgcttatggcaccgaaggggctgaaatgtgtagccaaatggcgggtctggatgat
aatattgcccgtattattgctgccttagatagtaacggtgttccttacgtcttggttctg
acagctgaccatggtggccaagatgtgcctgaacgtgcaaaattacgcggtgtggagacg
gctcaacgcgttgaccccgcgttatcgccagatcagctttctttgaggttggcagaacgt
tttcaattgagccataatcagccattattttttgccaatgaaccacaaggcgattggtat
attaaccgtaatttacccgagcaaacaaaagcacagcttattcaggctgcaaaatcggaa
ttatccaatcacccacaggtcgctgcggtttttaccgcatcagaattaacccatatccca
tatccaacccgttcacctgaattatggaatctggctgaaagagcgaaggcttcttttgat
ccgctacgttcgggggatttgattgtccttttaaaaccgcgcgtgacgcctattgccaaa
ccggtttcatatgtagcgacccatggatccgcatgggattatgatcggcgcgtccccatt
attttttacacgccgcatgcctccggttttgaacaacctatgccggttgaaaccgtcgac
attatgccaagcttagcggctctcttgcagattcctttgcgaaaaggggaggtcgatggc
cgctgtcttgatcttgatccaacggaagctaccacctgtcccgtaaaatag

DBGET integrated database retrieval system