KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1006Help
Entry
ZMO1006           CDS       T00221                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00790  Folate biosynthesis
zmo01100  Metabolic pathways
Module
zmo_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ZMO1006
Enzymes [BR:zmo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ZMO1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AAV89630
UniProt: Q5NNT0
Position
1023423..1024529
Genome map
AA seq 368 aa AA seqDB search
MSFYNQNVSVPEMTDIRLYFCPTAFVNAPMAPSGATFRLAGGLKWFGAFSVIMVSKGEIV
QERVISVADINSFLNSLSTEMQLDAYRTISRIVAPRAAIQLGKSKIRLDHTHIVGILNVT
PDSFSDGGLYQDNVDAACDMAKAMMDQGASLIDIGGESTRPGAEAVSEEEEKLRVMPVIE
KLKEASLPISVDTRKSSVISAVWEQTPAIFNDVSALSWDKNSLFIAAEKSYPVILMHHEE
GSIHEGSSKKILIEVYNWLEKRIEVAEAAGISRDRIIIDPGIGFGKSFQDNLALIRGIAL
FHGLGCPLMLGASRKKLIITFAGDTHPQERLGGSLAIALHAADQGVQLLRVHDVRDTAQA
LTVWQALY
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtctttttataaccaaaatgtttcagtacctgaaatgaccgatatccgtctttatttt
tgtccgaccgcctttgtgaatgcaccgatggcgccttcgggtgcaacattccgtttggct
ggaggcttgaaatggtttggcgctttttccgttatcatggtttcaaaaggcgaaattgtt
caggaacgggtgatttctgttgcggatatcaatagctttttgaacagcctttcaacagaa
atgcagttggacgcctatagaactatttcaaggattgtggcaccaagagcggctatccaa
ttaggtaaaagcaagatccggttagaccatacccatattgtcggtattttaaatgtgacg
cctgacagtttttcagatggcggtttatatcaagataacgttgatgcggcctgtgacatg
gccaaggcgatgatggatcagggtgcatctttgattgatatcggcggcgaatccacccgt
cccggagctgaagccgtatcagaagaagaggaaaaattgcgggtcatgccggtgattgag
aagctgaaagaggcttctctcccgatatcggttgatacccgaaaatcctcggtgatttcc
gctgtatgggaacagaccccggctatttttaatgatgtatctgctttgagttgggacaaa
aattctctctttatcgcggcagaaaaatcttatcccgtcattttgatgcatcatgaagaa
ggctcaatccatgaagggtcttctaaaaaaattctgatcgaggtttataactggctcgaa
aagcgtatagaggttgcggaagcggccggtattagccgtgaccggatcattattgatccc
ggtatcggttttggtaaaagttttcaggataatcttgccttgatccgtggcattgccttg
tttcacggtttggggtgtcccttgatgctgggggcaagtcgtaaaaaactgattattacc
tttgcaggtgacacccatcctcaagaaagattgggcggctctttggcgattgcgcttcat
gcggccgatcagggtgtccaattattgcgcgtccatgatgtcagagatacggcgcaagcg
ctgaccgtctggcaggctttatactaa

DBGET integrated database retrieval system