KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1086Help
Entry
ZMO1086           CDS       T00221                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1096459..1097478
Genome map
AA seq 339 aa AA seqDB search
MTYSRRFILSTLVSVPLLVACRKGKAAEADNWTLFKNRFFKDGRISDSGNGNISHSEGQG
YGMIQAEAAHDKATFDALWQWTKTHLMRPDMALFAWRFDPSQSNPVSDQNNATDGDILIA
WALLRAEKRWPKNGYGQDSEAIRKSIGKKLVLSGGGETILLPGLQGFTGTDYVILNFSYY
IWPALKAFNEADNGAWHNVIESGKKLLAKAKFGLPQLPTDWVAFKSNGNLEPAADKQPYF
GFDAVRIPLYLIWGGEDALAAPFAIYWNSYLSHNQPVPAWVDVNSQAIAPYPLSKGGMAI
LDLAMNKPITAKIADQDDYYSSALLALSEIAAKERPHNR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacctatagtcgtcgttttatcctttccactttggtaagcgtccctttgctggtagcc
tgtcggaagggtaaagcggccgaagctgataattggacattattcaagaatcgctttttt
aaagatggccggatttcagatagcggtaatggaaatatcagtcatagcgaaggacagggc
tatggcatgatacaagcagaagctgcccatgataaagcgacctttgatgctttgtggcag
tggacaaaaacgcatcttatgcggcctgatatggccctttttgcatggcgctttgatccg
tcccaatctaatccggtatcagaccagaataatgcgacggatggcgatattctgatcgca
tgggctttattgcgtgcagaaaagcgttggccaaagaacggttacgggcaggattccgaa
gcaattagaaaatctatcggtaagaagctggttctttctggtggtggtgaaaccattctg
cttcccggcttacagggttttaccggcactgattatgttattctgaatttctcttattat
atctggcctgcgttaaaagcctttaatgaggctgataacggggcttggcataatgttatt
gaaagcgggaaaaaattattggcaaaggctaaattcggtttgccacagttgcccactgat
tgggtcgctttcaaaagtaacggcaatcttgaacccgccgccgacaagcaaccttatttc
ggttttgatgccgttagaatcccgctctatctgatttgggggggagaagatgccttggca
gctccctttgctatttattggaatagctatctttcccataatcagcccgttccggcatgg
gtcgatgtgaatagccaagctattgcgccttatcctttatcaaaaggaggtatggctatt
cttgatctggcaatgaataaacccattaccgcgaaaattgccgatcaggatgattattat
tcttcagctttattggctctttccgaaattgctgcgaaagaaagaccgcataaccgctaa

DBGET integrated database retrieval system