KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1136Help
Entry
ZMO1136           CDS       T00221                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1151875..1153320)
Genome map
AA seq 481 aa AA seqDB search
MNIKALFGSAVVLAVVAYGATTSYLVHYDHETAPKLSSLSPTNNNPKAKAAFDTIAEARC
DYCHTKDAKLPFYASLPVAKQLMQRDIKRGLQHFQIQPVLNALEKGEAVDEESLARMQFV
VEHDMMPPKMYLTMHWHAALGEKGKKAMLEWIKESRIKNYDAAGLVAPQFQSEPIQPIPA
ADFSDKEKIALGERLFFDKQLSGDGTLNCASCHGLNKGGVDNLVTSTGIKGQKGPINAPT
VYNSVYNKLQFWDGRAKDLQEQAAGPVMNPLEMGSHDWAEVSKRVMAQPGYKEAFTKVYG
GQANQERITNAIAVYEATLVTPDSRFDQYLKGHENAINEQEKRGYALFKDLGCASCHVGK
AMGGQSFEVMGLEGDYFGKRGHPSDADQGRFSQTHNALDMHRFNVPTLRNIELTAPYFHD
GSAKTLEDAVREMVRYQTQKGQIPEKDVQDIVAFLKTQTGSYRGHNLATITEEEAGILPS
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcaaggctttattcgggtctgcggtcgtcttggcagtggtggcctatggggca
acaacctcttatctggttcattacgatcatgaaacagcgcccaaactttcttcgctgtcc
ccgacaaataacaatccgaaagccaaggctgcctttgatacaattgcagaagcccgctgc
gattactgtcataccaaagatgctaaactgcctttttatgctagcttgcccgttgcaaaa
cagttgatgcagcgtgacatcaaacgcgggttacagcatttccagatacaaccggtttta
aatgccttggaaaaaggcgaagcggtcgatgaagaatccttggcaagaatgcagttcgtc
gttgaacatgacatgatgccgccgaaaatgtatctcaccatgcattggcatgctgccctt
ggtgaaaagggcaaaaaggctatgctggaatggatcaaggaaagccggattaaaaattat
gatgcggctgggcttgttgcgcctcaatttcagtccgaaccgatacagcctattccggca
gctgatttttctgacaaagaaaaaatcgcccttggggaacgtctgttctttgataaacag
ctttctggcgatggcactttaaattgtgccagctgtcacggcctgaacaagggtggggtg
gataatctcgtcacctctacgggtatcaaaggacaaaagggtcccattaacgcgcctact
gtttacaattcggtttataacaaactgcaattctgggatggccgagcaaaagatttacag
gagcaggcggcgggccctgtcatgaatcctctggaaatgggttcccatgattgggcagaa
gttagcaagcgcgttatggcacagccgggctataaagaagcctttacaaaggtctatggc
ggtcaggccaatcaggaacgtattaccaatgcaatcgctgtttatgaggcgactttggta
acgcctgacagtcgttttgaccaatatttaaaaggccatgaaaacgcgatcaacgaacag
gaaaaacgcggttacgcgttgtttaaagatctgggttgtgcttcttgccatgtcggtaaa
gcgatgggtggtcaaagttttgaagtcatgggacttgaaggtgactatttcggtaaaaga
ggtcacccaagtgatgccgatcaaggccgtttctctcaaacgcataatgcccttgatatg
catcgtttcaatgtgccaacattacggaatattgaattgacggcaccttatttccacgat
ggcagcgccaaaactttggaagacgctgttcgtgaaatggtgcgctaccagacgcagaaa
ggccaaattcctgaaaaggatgttcaggatattgtggccttcttgaaaactcaaacggga
agctatcgcggccataatctggcaacgatcacagaagaagaagcaggcatattgccttct
aaataa

DBGET integrated database retrieval system