KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1200Help
Entry
ZMO1200           CDS       T00221                                 

Definition
RpiB/LacA/LacB family sugar-phosphate isomerase (EC:5.3.1.26)
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ZMO1200
   01230 Biosynthesis of amino acids
    ZMO1200
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ZMO1200
   00051 Fructose and mannose metabolism
    ZMO1200
Enzymes [BR:zmo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     ZMO1200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1224690..1225163
Genome map
AA seq 157 aa AA seqDB search
MTSAVPSNTKKKLVIASDHAAFELKSTLITWLKELGHEVEDLGPHENHSVDYPDYGYKLA
VAIAEKTADFGIALCGSGIGISIAVNRHPAARCALITDNLTARLAREHNNANVIAMGARL
IGIETAKDCISAFLATPFGGERHVRRIDKLSNPQFNI
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtgacctctgctgtgccatcaaatacgaaaaaaaagctggtgattgcttccgatcacgca
gcatttgagttgaaatcaaccttgattacttggctgaaagagcttggtcatgaggtcgaa
gaccttggccctcatgaaaaccattcagtcgattatcccgattacggttataagctggct
gtcgctatcgcagaaaaaaccgctgatttcggtattgctttatgtggctcgggaatcggt
atctcgatcgctgtcaatcgccatccggctgcccgttgcgctttgattacggataacctt
accgcccgtttggcaagagaacataacaatgccaatgttatcgctatgggtgcgagattg
atcggcattgaaaccgctaaggattgtatttcagctttccttgcaacgccgtttggaggt
gaacgtcatgttcgccgtatcgataaactttcgaatcctcagttcaatatctag

DBGET integrated database retrieval system