KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1200Help
Entry
ZMO1200           CDS       T00221                                 

Definition
(GenBank) sugar-phosphate isomerase, RpiB/LacA/LacB family
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00030  Pentose phosphate pathway
zmo00051  Fructose and mannose metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01130  Biosynthesis of antibiotics
zmo01200  Carbon metabolism
zmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ZMO1200
   00051 Fructose and mannose metabolism
    ZMO1200
Enzymes [BR:zmo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     ZMO1200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB Gly_rich_SFCGS
Motif
Other DBs
NCBI-ProteinID: AAV89824
UniProt: Q5NN86
Position
1224690..1225163
Genome map
AA seq 157 aa AA seqDB search
MTSAVPSNTKKKLVIASDHAAFELKSTLITWLKELGHEVEDLGPHENHSVDYPDYGYKLA
VAIAEKTADFGIALCGSGIGISIAVNRHPAARCALITDNLTARLAREHNNANVIAMGARL
IGIETAKDCISAFLATPFGGERHVRRIDKLSNPQFNI
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtgacctctgctgtgccatcaaatacgaaaaaaaagctggtgattgcttccgatcacgca
gcatttgagttgaaatcaaccttgattacttggctgaaagagcttggtcatgaggtcgaa
gaccttggccctcatgaaaaccattcagtcgattatcccgattacggttataagctggct
gtcgctatcgcagaaaaaaccgctgatttcggtattgctttatgtggctcgggaatcggt
atctcgatcgctgtcaatcgccatccggctgcccgttgcgctttgattacggataacctt
accgcccgtttggcaagagaacataacaatgccaatgttatcgctatgggtgcgagattg
atcggcattgaaaccgctaaggattgtatttcagctttccttgcaacgccgtttggaggt
gaacgtcatgttcgccgtatcgataaactttcgaatcctcagttcaatatctag

DBGET integrated database retrieval system