KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1236Help
Entry
ZMO1236           CDS       T00221                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ZMO1236
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO1236
  Lipid metabolism
   00071 Fatty acid degradation
    ZMO1236
  Amino acid metabolism
   00350 Tyrosine metabolism
    ZMO1236
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ZMO1236
   00626 Naphthalene degradation
    ZMO1236
Enzymes [BR:zmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ZMO1236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1259369..1260382)
Genome map
AA seq 337 aa AA seqDB search
MKAAVITKDHTIEVKDTKLRPLKYGEALLEMEYCGVCHTDLHVKNGDFGDETGRITGHEG
IGIVKQVGEGVTSLKVGDRASVAWFFKGCGHCEYCVSGNETLCRNVENAGYTVDGAMAEE
CIVVADYSVKVPDGLDPAVASSITCAGVTTYKAVKVSQIQPGQWLAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLAFAKELGADMVINPKNEDAAKIIQEKVGGAHATVVTAVAKS
AFNSAVEAIRAGGRVVAVGLPPEKMDLSIPRLVLDGIEVLGSLVGTREDLKEAFQFAAEG
KVKPKVTKRKVEEINQIFDEMEHGKFTGRMVVDFTHH
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagccgtcataactaaagatcatacgatcgaagtgaaagacaccaaattacgc
cctctgaaatacggggaagcgcttttggaaatggaatattgcggggtatgtcataccgat
ctccacgtgaaaaacggggattttggcgatgaaaccggcagaattaccggccatgaaggc
atcggtatcgtcaagcaggtcggggaaggggttacttctctgaaagtcggtgaccgtgcc
agtgttgcatggttcttcaaaggctgcggccattgcgaatattgtgtcagtggaaatgaa
acgctttgccgcaacgttgaaaatgccggttatacggttgacggcgctatggcagaagaa
tgcatcgtcgttgccgattactcggtcaaagtgccagatggtcttgatcctgcggttgcc
agcagcatcacttgcgcgggtgtaaccacctataaagcagtcaaagtttctcagatacag
ccgggacaatggctggctatctatggcttgggcggtttaggcaatctagcccttcaatat
gccaagaatgttttcaacgccaaagtgatcgcgatcgatgtcaatgatgaacagctcgct
tttgccaaagagctgggcgcagatatggtcatcaatccgaaaaacgaagatgctgccaaa
atcattcaggaaaaagtcggcggcgcacatgcgacggtggtgacagctgttgccaaatcc
gcctttaactcggctgttgaggctatccgcgcgggtggccgtgttgtcgccgttggtctg
cctcctgaaaaaatggatttgagcattcctcgcttggtgcttgacggtatcgaagtctta
ggttctttggtcggaacgcgggaagatttgaaagaagccttccagtttgcagccgaaggt
aaggtcaaaccgaaagtcaccaagcgtaaagtcgaagaaatcaaccaaatctttgacgaa
atggaacatggtaaattcacaggccgtatggttgttgattttacccatcactag

DBGET integrated database retrieval system