KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1236Help
Entry
ZMO1236           CDS       T00221                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo00350  Tyrosine metabolism
zmo00625  Chloroalkane and chloroalkene degradation
zmo00626  Naphthalene degradation
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01130  Biosynthesis of antibiotics
zmo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:zmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO1236
  Lipid metabolism
   00071 Fatty acid degradation
    ZMO1236
  Amino acid metabolism
   00350 Tyrosine metabolism
    ZMO1236
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ZMO1236
   00626 Naphthalene degradation
    ZMO1236
Enzymes [BR:zmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ZMO1236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Methyltransf_25 CoA_binding 2-Hacid_dh_C TrkA_N PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AAV89860
UniProt: P20368
Position
complement(1259369..1260382)
Genome map
AA seq 337 aa AA seqDB search
MKAAVITKDHTIEVKDTKLRPLKYGEALLEMEYCGVCHTDLHVKNGDFGDETGRITGHEG
IGIVKQVGEGVTSLKVGDRASVAWFFKGCGHCEYCVSGNETLCRNVENAGYTVDGAMAEE
CIVVADYSVKVPDGLDPAVASSITCAGVTTYKAVKVSQIQPGQWLAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLAFAKELGADMVINPKNEDAAKIIQEKVGGAHATVVTAVAKS
AFNSAVEAIRAGGRVVAVGLPPEKMDLSIPRLVLDGIEVLGSLVGTREDLKEAFQFAAEG
KVKPKVTKRKVEEINQIFDEMEHGKFTGRMVVDFTHH
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagccgtcataactaaagatcatacgatcgaagtgaaagacaccaaattacgc
cctctgaaatacggggaagcgcttttggaaatggaatattgcggggtatgtcataccgat
ctccacgtgaaaaacggggattttggcgatgaaaccggcagaattaccggccatgaaggc
atcggtatcgtcaagcaggtcggggaaggggttacttctctgaaagtcggtgaccgtgcc
agtgttgcatggttcttcaaaggctgcggccattgcgaatattgtgtcagtggaaatgaa
acgctttgccgcaacgttgaaaatgccggttatacggttgacggcgctatggcagaagaa
tgcatcgtcgttgccgattactcggtcaaagtgccagatggtcttgatcctgcggttgcc
agcagcatcacttgcgcgggtgtaaccacctataaagcagtcaaagtttctcagatacag
ccgggacaatggctggctatctatggcttgggcggtttaggcaatctagcccttcaatat
gccaagaatgttttcaacgccaaagtgatcgcgatcgatgtcaatgatgaacagctcgct
tttgccaaagagctgggcgcagatatggtcatcaatccgaaaaacgaagatgctgccaaa
atcattcaggaaaaagtcggcggcgcacatgcgacggtggtgacagctgttgccaaatcc
gcctttaactcggctgttgaggctatccgcgcgggtggccgtgttgtcgccgttggtctg
cctcctgaaaaaatggatttgagcattcctcgcttggtgcttgacggtatcgaagtctta
ggttctttggtcggaacgcgggaagatttgaaagaagccttccagtttgcagccgaaggt
aaggtcaaaccgaaagtcaccaagcgtaaagtcgaagaaatcaaccaaatctttgacgaa
atggaacatggtaaattcacaggccgtatggttgttgattttacccatcactag

DBGET integrated database retrieval system